A novel defensin‐like peptide from salivary glands of the hard tick,Haemaphysalis longicornis |
| |
Authors: | Xiangyun Lu Qiaolin Che Yi Lv Meijuan Wang Zekuan Lu Feifei Feng Jingze Liu Haining Yu |
| |
Affiliation: | 1. Key Laboratory of Microbiological Engineering of Agricultural Environment, Life Sciences College of Nanjing Agricultural University, Ministry of Agriculture, Nanjing, Jiangsu, 210095 China;2. Department of Life Science & Technology, Changshu Institute of Technology, Changshu, Jiangsu, 215500 China;3. The first two authors share the same contribution to this paper;4. College of Life Sciences, Hebei Normal University, Shijiazhuang, Hebei, 050016 China;5. Department of Bioscience and Biotechnology, Dalian University of Technology, Dalian, Liaoning, 116023 China |
| |
Abstract: | A novel defensin‐like antimicrobial peptide named longicornsin was isolated from the salivary glands of the hard tick, Haemaphysalis longicornis, using a 10‐kDa cut‐off Centriprep filter and reversed‐phase high‐performance liquid chromatography (RP‐HPLC). Its amino acid sequence was determined as DFGCGQGMIFMCQRRCMRLYPGSTGFCRGFRCMCDTHIPLRPPFMVG by Edman degradation. The cDNA encoding longicornsin was cloned by cDNA library screening. The predicted protein from the cDNA sequence was composed of 78 amino acids including a mature longicornsin. It showed similarity with defensin‐like peptides from other ticks by BLAST search. Different from most other tick defensin‐like peptides, longicornsin had a C‐terminal extension. Purified longicornsin exerted potent antimicrobial activities against bacteria and fungi. Interestingly, it even showed strong antimicrobial ability against drug‐resistant microorganisms and Helicobacter pylori. The results of this study indicated that longicornsin is a potential candidate for novel antimicrobial drug design. |
| |
Keywords: | tick antimicrobial peptide defensin salivary gland Haemaphysalis longicornis |
|
|