Vascular effects and electrolyte homeostasis of the natriuretic peptide isolated from Crotalus oreganus abyssus (North American Grand Canyon rattlesnake) venom |
| |
| Authors: | Da Silva S L Dias-Junior C A Baldasso P A Damico D C S Carvalho B M A Garanto A Acosta G Oliveira E Albericio F Soares A M Marangoni S Resende R R |
| |
| Institution: | 1. Federal University of São João Del Rei Campus Alto Paraopeba, 36420-000 Ouro Branco, Minas Gerais, Brazil;2. Universidade Estadual Paulista Júlio de Mesquita Filho, 18618-970 Botucatu, São Paulo, Brazil;3. Oswaldo Cruz Foundation, Federal University of Rondonia, Porto Velho, Rondônia, Brazil;4. Department of Biochemistry of Biology Institute, State University of Campinas, Campinas 13083-970, São Paulo, Brazil;5. Proteomics Platform, Barcelona Science Park, University of Barcelona, 08028 Barcelona, Spain;6. Institute for Research in Biomedicine, Barcelona Science Park, University of Barcelona, 08028 Barcelona, Spain;g CIBER-BBN, Networking Centre on Bioengineering Biomaterials and Nanomedicine, Barcelona Science Park, 08028 Barcelona, Spain;h Department of Organic Chemistry, University of Barcelona, 08028 Barcelona, Spain;i Department of Biochemistry and Immunology, Institute of Biological Sciences, Federal University of Minas Gerais, 31270-901 Belo Horizonte, Minas Gerais, Brazil |
| |
| Abstract: | Crotalus oreganus abyssus is a rattlesnake that is usually found in the Grand Canyon, United States of America. Knowledge regarding the composition of C. o. abyssus venom is scarce. New natriuretic peptides (NPs) have been isolated and characterized from the venoms of members of the Crotalinae family. The NP family comprises three members, ANP (atrial natriuretic peptide), BNP (b-type natriuretic peptide) and CNP (c-type natriuretic peptide), and has an important role in blood pressure regulation and electrolyte homeostasis. The aim of the present study was to characterize a novel natriuretic-like peptide (Coa_NP2), isolated from C. o. abyssus venom. The Coa_NP2 presents an average molecular mass of 3419.88Da (theoretical average molecular mass 3418.94Da, monoisotopic molecular mass 3416.66Da and theoretical PI 7.78) and its amino acid sequence presents the loop region that is characteristic of natriuretic peptides. The peptide has 32 amino acids and its complete sequence is SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP. Coa_NP2 is a natriuretic peptide of the ANP/BNP-like family, since the carboxyterminal region of CNP has its own NP domain. We demonstrate, herein, that Coa_NP2 produces a dose-dependent decrease in mean arterial pressure in rats, followed by significant increases in concentrations of markers of nitric oxide formation measured in the plasma and vasorelaxation in a thoracic aortic ring bath. The structural and biological aspects confirm Coa_NP2 as a new natriuretic peptide, isolated from snake venom. |
| |
| Keywords: | Crotalus oreganus abyssus Hypotensive agents Snake venoms Natriuretc peptides Nitric oxide |
| 本文献已被 ScienceDirect PubMed 等数据库收录！ |
|
