Synthetic conformational antigen which simulates the extracellular part of the M2-muscarinic receptor: interaction with blood sera of patients suffering from idiopathic arrhythmias

Fragments corresponding to the 83–98 sequence of the first extracellular loop and to the 168–192 and 171–182 sequences of the second extracellular loop of the M2-muscarinic receptor (antibodies to this receptor could be markers of early symptoms of heart disorders) were synthesized by solid phase method using the Fmoc-SPPS strategy. A new conformational antigen with the natural location of the disulfide bridge was prepared by selective formation of disulfide bond between the corresponding cysteine residues in the synthe-sized peptides and characterized. The comparative analysis of reactivity of the synthesized peptides towards sera from patients which had no organic heart disease was performed. A new conformational antigen was effectively bound to the sera from patients with idiopathic arrhythmias, but without symptoms of organic heart disease.     

Convergent Synthesis of the Rat Galanin and Study of Its Biological Activity

Russian Journal of Bioorganic Chemistry - The full-length rat galanin (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2, G29) was prepared by the solid phase peptide synthesis using the Fmoc-strategy. The peptide...     

Chimeric Agonist of Galanin Receptor GALR2 Reduces Heart Damage in Rats with Streptozotocin-Induced Diabetes

Biochemistry (Moscow) - Neuropeptide galanin and its N-terminal fragments reduce the generation of reactive oxygen species and normalize metabolic and antioxidant states of myocardium in...     

Optimization of the Synthesis of an Apelin-12 Structural Analog and the NMR Study of Its Stability in Human Plasma

Russian Journal of Bioorganic Chemistry - A method for the solid-phase synthesis of the apelin-12 analog has been developed using the Fmoc methodology in combination with the temporary protection...     

Optimal Method for Disulfide Bond Closure in the Synthesis of Atosiban—Antagonist of Oxytocin Receptors

Russian Journal of Bioorganic Chemistry - This work is devoted to the large-scale solid-phase synthesis (SPS) of Atosiban, Mpa1-D-Tyr(OEt)-Ile-Thr-Asn-Cys6-Pro-Orn-Gly-NH2 cyclic 1,6 disulfide, the...     

Solid-phase fragment condensation for synthesis of peptides from the immunodominant sequence of β<Subscript>1</Subscript>-adrenoreceptor

The P26 peptide corresponding to the 197–222 sequence of the second extracellular loop of the β₁-adrenoreceptor (β₁-AR) was synthesized by solid-phase fragment condensation on the Wang polymer. Pentapeptide fragments were prepared on the 2-chlorotrityl resin. The racemization degree of the C-terminal alanine residue of the pentapeptide was experimentally evaluated for the synthetic H-Glu-Ser-Asp-Glu-Ala-Arg-OH hexapeptide β₁-АR-(202–207) which was prepared by the 5 + 1 fragment condensation with the use of various condensing agents. A content of the diastereoisomeric peptide in the products of the fragment condensation was determined by HPLC on a reversed phase. The D-alanine-containing hexapeptide was specially synthesized and used for a comparison. The minimum racemization degree of the C-terminal alanine residue was observed if complex F was applied to the synthesis of the hexapeptide.     

Optimization of the Solid Phase Synthesis of the Ingramon Peptide Antagonist of the Human Monocyte Chemoattractant Protein 1 (MCP-1)

Russian Journal of Bioorganic Chemistry - The solid phase synthesis (SPS) of the ingramon peptide antagonist of the human monocyte chemoattractant protein-1...     

Antioxidant Properties of Galanin and Its N-Terminal Fragments in in vitro and in vivo Oxidative Stress Modeling

Biochemistry (Moscow) - Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue...     

Fragments of the Galanin Peptide and Their Synthetic Analogues with the Cardioprotective Effect

Russian Journal of Bioorganic Chemistry - New peptide analogs of galanin corresponding to fragments of the N-terminal sequence were synthesized by an automatic solid-phase method using...