The endocrine cells in the gastroenteropancreatic system of the bowfin, Amia calva L.: an immunohistochemical, ultrastructural, and immunocytochemical analysis.

The gastroenteropancreatic (GEP) endocrine system of bowfin (Amia calva) was described using light and electron microscopy and immunological methods. The islet organ (endocrine pancreas) consists of diffusely scattered, mostly small islets and isolated patches of cells among and within the exocrine acini. The islets are composed of abundant, centrally located B cells immunoreactive to bovine and lamprey insulin antisera and D cells showing a widespread distribution and specificity to somatostatin antibodies. A and F cells are present at the very periphery of the islets and are immunoreactive with antisera against glucagon (and glucagon-like peptide) and several peptides of the pancreatic polypeptide (PP)-family, respectively. The peptides of the two families usually collocates within the same peripheral islet cells and are the most common immunoreactive peptides present in the extra-islet tissue. Immunocytochemistry and fine structural observations characterised the granule morphology for B and D cells and identified two cell types with granules immunoreactive to glucagon antisera. These two putative A cells had similar granules, which were distinct from either B or D cells, but one of the cells had rod-shaped cytoplasmic inclusions within cisternae of what appeared to be rough endoplasmic reticulum. The inclusions were not immunoreactive to either insulin or glucagon antisera. Only small numbers of cells in the stomach and intestine immunoreacted to antisera against somatostatin, glucagon, and PP-family peptides. The paucity of these cells was reflected in the low concentrations of these peptides in intestinal extracts. The GEP system of bowfin is not unlike that of other actinopterygian fishes, but there are some marked differences that may reflect the antiquity of this system and/or may be a consequence of the ontogeny of this system in this species.     

Immunohistochemical observations of the endocrine pancreas during metamorphosis of the sea lamprey,Petromyzon marinus L.

Summary Light-microscopic immunohistochemistry was used to localize insulin- and somatostatin-immunoreactive cells within developing endocrine pancreatic tissue of metamorphosing lampreys, Petromyzon marinus. The extrahepatic common bile duct and a portion of the intrahepatic bile duct develop into the caudal portion of the endocrine pancreas. The cranial pancreas is composed of follicles originating in the intestinal and diverticular epithelia, thus following the method of formation of pancreatic follicles from gut epithelium in larvae. In both the cranial and caudal portions, and in an intermediate cord of isolated follicles which connect these two major masses, insulin-immunoreactive cells appear first and are followed by cells showing somatostatin-immunoreactivity. In all stages of metamorphosis individual endocrine cells demonstrate immunoreactivity to a single hormone. Biliary atresia in lamprey may have some adaptive significance in providing cells that produce a caudal endocrine pancreas.Supported by NSERC of Canada grant No. A5945 and MRC of Canada grant No. MA8629 to JHY     

Ultrastructure of the pronephric kidney of embryos and prolarvae of the sea lamprey, Petromyzon marinus

Embryos of lampreys Petromyzon marinus were obtained through a technique of artificial fertilization. Samples of developmental intervals to the prolarval stage were prepared for transmission electron microscopy and the pronephros was examined. The pronephros was visible in the cardiac region of the coelom prior to the time of hatching of embryos and consisted of a renal corpuscle, nephrostomes, and proximal tubules connected to a pronephric duct. The renal corpuscle was comprised of poorly-defined vascular channels and a visceral epithelium of yolk-filled cells, the podocytes, with short major processes and pedicels resting on a basal lamina. The first proximal tubules possessed a delicate brush border of short microvilli but subsequent cellular differentiation yielded cells with all the components required for the process of endocytosis, a process which was demonstrated by uptake of the tracer, horseradish peroxidase. The distal tubules appeared later in development and were noted for abundant mitochondria and an extensive smooth tubular network. The timing of differentiation of various components of the nephron corresponds to that seen during morphogenesis of other vertebrate kidneys.     

Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)

Three major forms of somatostatin were isolated from pancreas of the lamprey (Petromyzon marinus). One of the two major forms is a 14-residue somatostatin (SS-14) having the sequence AGCKNFFWKTFSSC. The homologous substitution Ser for Thr in position 12 is the first example of SS-14 from vertebrate preprosomatostatin gene I having a divergent sequence. The longest form is 37 residues in length (SS-37) and has the sequence ALRAAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC. A 34-residue form (SS-34) identical in sequence but truncated at a single Arg residue at position 3 of SS-37 was also isolated. The yields of the three forms were SS-37 (0.43 nmol/g), SS-34 (134 nmol/g), and SS-14 (51.5 nmol/g). The identification of this nested series of somatostatins suggests that prosomatostatin processing in lamprey more closely resembles that observed for procholecystokinin than that of mammalian or other piscine prosomatostatins. Somatostatin-producing cells in the lamprey pancreas were identified by immunostaining using antiserum against SS-34 and anti-serum against mammalian SS-14.     

Iron loading in the livers of metamorphosing lampreys,Petromyzon marinus L.

Iron loading of hepatocytes was followed through the stages (1-7) of metamorphosis in lamprey (Petromyzon marinus L.) using light- and electron-microscopic histochemistry. Iron is present in ferric and ferrous forms in the hepatocytes of larval lampreys in levels that can only be detected in the electron microscope. During the initial stages (1-3) of metamorphosis iron begins to increase in the cytoplasmic matrix and in dense bodies but it is not apparent in the light microscope until stage 4. The increased accumulation of iron through the subsequent stages (5-7) of metamorphosis coincides with the advanced degeneration and ultimate disappearance of bile canaliculi and bile ducts. The absence of a bile canaliculus is concurrent with the beginning of staining of lateral cell borders for ferrous iron and with intense concentrations of ferric iron throughout the cytoplasmic matrix and within cytoplasmic dense bodies. By the end of metamorphosis the hepatocytes resemble iron-loaded hepatocytes in pathological and experimentally induced situations in other vertebrates. The iron loading of hepatocytes during metamorphosis is discussed with respect to both the concomitant atresia of the biliary tree and alteration of several aspects of blood morphology and chemistry. Since iron loading occurs synchronously in the hepatocytes of a given population of metamorphosing lampreys, this organism should prove to be a useful experimental system for investigation on cellular mechanisms of iron loading in vertebrates.     

Morphological changes in the liver of the sea lamprey, Petromyzon marinus L., during metamorphosis: I. Atresia of the bile ducts

The bile ducts in the liver of larval sea lamprey, Petromyzon marinus, undergo programmed degeneration during metamorphosis. The degenerative process is most dramatic in the middle metamorphic stages (3-5), and is asynchronous, occurring more rapidly in small peripheral biliary components than in larger, medial ducts. All classes of bile ducts within the biliary tree exhibit similar histological changes during regression. The initial evidence of degeneration in the epithelium is a folding of the basal lamina, and this is accompanied by cell shrinkage and disruption of cell order. "Shedding" of microvilli and cytoplasmic constituents then takes place at the apical surface resulting in the accumulation of periodic acid-Schiff positive membranous debris in the Lumen. The appearance of "hyalin bodies" in the lumen coincides with the depletion of intermediate-sized filaments from the cytoplasmic matrix. Numerous, large dense bodies, myelin figures, and autophagic vacuoles are consistently observed in necrotic cells. Following cytolysis, bile duct remnants become ensheathed within regions of fibrosis. Ultimately, these fibrous regions are replaced with cords of hepatocytes. By stage 7, all bile ducts have disappeared. The events of biliary atresia in lampreys are comparable to tissue regression which is associated with normal development and pathological conditions in other vertebrates but are particularly reminiscent of those in human biliary atresia. The unique ability of the adult lamprey to service without bile ducts enhances the value of this organism as an experimental model for studying human biliary atresia.     

Molecular evolution of peptide tyrosine--tyrosine: primary structure of PYY from the lampreys Geotria australis and Lampetra fluviatilis, bichir, python and desert tortoise

Peptide tyrosine-tyrosine (PYY) has been isolated from the intestines of two species of reptile, the desert tortoise Gopherus agassizii (Testudines) and the Burmese python Python molurus (Squamata), from the primitive Actinopterygian fish, the bichir Polypterus senegalis (Polypteriformes) and from two agnathans, the Southern-hemisphere lamprey Geotria australis (Geotriidae) and the holarctic lamprey Lampetra fluviatilis (Petromyzontidae). The primary structure of bichir PYY is identical to the proposed ancestral sequence of gnathostome PYY (YPPKPENPGE10/DAPPEELAKY20/YSALR HYINL30/ITRQRY). Tortoise and python PYY differ by six and seven residues, respectively, from the ancestral sequence consistent with the traditional view that the Testudines represent an earlier divergence from the primitive reptilian stock than the Squamates. The current views of agnathan phylogeny favor the hypothesis that the Southern-hemisphere lampreys and the holarctic lampreys arose from a common ancestral stock but their divergence is of a relatively ancient (pre-Tertiary) origin. The Geotria PYY-related peptide shows only two amino acid substitutions (Pro10-->Gln and Leu22-->Ser) compared with PYY from the holarctic lamprey Petromyzon marinus. This result was unexpected as Petromyzon PYY differs from Lampetra PYY deduced from the nucleotide sequence of a cDNA (S?derberg et al. J. Neurosci. Res. 1994;37:633-640) by 10 residues. However, a re-examination of an extract of Lampetra intestine revealed the presence of a PYY that differed in primary structure from Petromyzon PYY by only one amino acid residue (Pro10-->Ser). This result suggests that the structure of PYY has been strongly conserved during the evolution of Agnatha and that at least two genes encoding PYY-related peptides are expressed in Lampetra tissues.     

Lamprey parasitism of sharks and teleosts: high capacity urea excretion in an extant vertebrate relic

We observed 10 sea lampreys (Petromyzon marinus) parasitizing basking sharks (Cetorhinus maximus), the world's second largest fish, in the Bay of Fundy. Due to the high concentrations of urea in the blood and tissues of ureosmotic elasmobranchs, we hypothesized that sea lampreys would have mechanisms to eliminate co-ingested urea while feeding on basking sharks. Post-removal urea excretion rates (J(Urea)) in two lampreys, removed from separate sharks by divers, were initially 450 ( approximately 9000 micromol N kg-1 h-1) and 75 times ( approximately 1500 micromol N kg-1 h-1) greater than basal (non-feeding) rates ( approximately 20 micromol N kg-1 h-1). In contrast, J(Urea) increased by 15-fold after parasitic lampreys were removed from non-ureosmotic rainbow trout (Oncorhynchus mykiss). Since activities of the ornithine urea cycle (OUC) enzymes, carbamoyl phosphate synthetase III (CPSase III) and ornithine carbamoyl transferase (OCT) were relatively low in liver and below detection in intestine and muscle, it is unlikely that the excreted urea arose from de novo urea synthesis. Measurements of arginase activity suggested that hydrolysis of dietary arginine made a minor contribution to J(Urea.). Post-feeding ammonia excretion rates (J(Amm)) were 15- to 25-fold greater than basal rates in lampreys removed from both basking sharks and rainbow trout, suggesting that parasitic lampreys have a high capacity to deaminate amino acids. We conclude that the sea lamprey's ability to penetrate the dermal denticle armor of sharks, to rapidly excrete large volumes of urea and a high capacity to deaminate amino acids, represent adaptations that have contributed to the evolutionary success of these phylogenetically ancient vertebrates.     

The Agnathan Enteropancreatic Endocrine System: Phylogenetic and Ontogenetic Histories, Structure, and Function

The extant jawless fishes (Agnatha) include the hagfishes andlampreys whose ancestry can be traced through a conserved evolutionto the earliest of vertebrates. This review traces the studyof the enteropancreatic (EP), endocrine cells and their productsin hagfishes and lampreys over the past two centuries. ErikaPlisetskaya is one of several prominent comparative endocrinologistswho studied the development, distribution or function of theagnathan EP system. Her physiological studies in Russia laidthe foundation for her subsequent isolation in North Americaof the first lamprey EP peptides (insulin and somatostatin)and providing the first homologous radioimmunoassay for agnathan(lamprey) insulin. This review also emphasizes the nature andthe method of development of the agnathan endocrine pancreas(islet organ), for it reflects the earliest vertebrate endocrinepancreas originating from intestinal and/or bile-duct epithelia.The lamprey life cycle includes a protracted larval period anda metamorphosis when the adult EP system develops. Differencesin morphogenesis during metamorphosis of southern- and northern-hemispherelampreys dictate that a single cranial mass (islet organ) appearin the former and both a cranial and a caudal principal isletcomprises most of the islet organ in holarctic species. Thereare differences in distribution of cell types and in the primarystructure of the peptides in the definitive islet organ of hagfishesand lampreys. The primary structures of insulin, somatostatins,glucagons, glucagon-like peptide, and peptide tyrosine tyrosineare now available for three lamprey species representing threegenera and two of the three families. Differences in structureof peptides within, and between, families is providing supportfor earlier views on the time of divergence of the familiesand the different genera. It is concluded that due to the ancientlineage and successful habitation of lampreys and hagfishes,and the importance of the EP system to their survival, thattheir EP systems should be a research focus well into the nextcentury.