Nedd4-2 functionally interacts with ClC-5: involvement in constitutive albumin endocytosis in proximal tubule cells

Constitutive albumin uptake by the proximal tubule is achieved by a receptor-mediated process in which the Cl(-) channel, ClC-5, plays an obligate role. Here we investigated the functional interaction between ClC-5 and ubiquitin ligases Nedd4 and Nedd4-2 and their role in albumin uptake in opossum kidney proximal tubule (OK) cells. In vivo immunoprecipitation using an anti-HECT antibody demonstrated that ClC-5 bound to ubiquitin ligases, whereas glutathione S-transferase pull-downs confirmed that the C terminus of ClC-5 bound both Nedd4 and Nedd4-2. Nedd4-2 alone was able to alter ClC-5 currents in Xenopus oocytes by decreasing cell surface expression of ClC-5. In OK cells, a physiological concentration of albumin (10 mug/ml) rapidly increased cell surface expression of ClC-5, which was also accompanied by the ubiquitination of ClC-5. Albumin uptake was reduced by inhibiting either the lysosome or proteasome. Total levels of Nedd4-2 and proteasome activity also increased rapidly in response to albumin. Overexpression of ligase defective Nedd4-2 or knockdown of endogenous Nedd4-2 with small interfering RNA resulted in significant decreases in albumin uptake. In contrast, pathophysiological concentrations of albumin (100 and 1000 mug/ml) reduced the levels of ClC-5 and Nedd4-2 and the activity of the proteasome to the levels seen in the absence of albumin. These data demonstrate that normal constitutive uptake of albumin by the proximal tubule requires Nedd4-2, which may act via ubiquitination to shunt ClC-5 into the endocytic pathway.     

Molecular evolution of olfactomedin

Olfactomedin is a secreted polymeric glycoprotein of unknown function,originally discovered at the mucociliary surface of the amphibian olfactoryneuroepithelium and subsequently found throughout the mammalian brain. As afirst step toward elucidating the function of olfactomedin, itsphylogenetic history was examined to identify conserved structural motifs.Such conserved motifs may have functional significance and provide targetsfor future mutagenesis studies aimed at establishing the function of thisprotein. Previous studies revealed 33% amino acid sequence identity betweenrat and frog olfactomedins in their carboxyl terminal segments. Furtheranalysis, however, reveals more extensive homologies throughout themolecule. Despite significant sequence divergence, cysteines essential forhomopolymer formation such as the CXC motif near the amino terminus areconserved, as is the characteristic glycosylation pattern, suggesting thatthese posttranslational modifications are essential for function.Furthermore, evolutionary analysis of a region of 53 amino acids of fish,frog, rat, mouse, and human olfactomedins indicates that an ancestralolfactomedin gene arose before the evolution of terrestrial vertebrates andevolved independently in teleost, amphibian, and mammalian lineages.Indeed, a distant olfactomedin homolog was identified in Caenorhabditiselegans. Although the amino acid sequence of this invertebrate protein islonger and highly divergent compared with its vertebrate homologs, theprotein from C. elegans shows remarkable similarities in terms of conservedmotifs and posttranslational modification sites. Six universally conservedmotifs were identified, and five of these are clustered in the carboxylterminal half of the protein. Sequence comparisons indicate that evolutionof the N-terminal half of the molecule involved extensive insertions anddeletions; the C-terminal segment evolved mostly through point mutations,at least during vertebrate evolution. The widespread occurrence ofolfactomedin among vertebrates and invertebrates underscores the notionthat this protein has a function of universal importance. Furthermore,extensive modification of its N-terminal half and the acquisition of aC-terminal SDEL endoplasmic-reticulum- targeting sequence may have enabledolfactomedin to adopt new functions in the mammalian central nervoussystem.     

Isolation and characterization of a variant somatostatin-14 and two related somatostatins of 34 and 37 residues from lamprey (Petromyzon marinus)

Three major forms of somatostatin were isolated from pancreas of the lamprey (Petromyzon marinus). One of the two major forms is a 14-residue somatostatin (SS-14) having the sequence AGCKNFFWKTFSSC. The homologous substitution Ser for Thr in position 12 is the first example of SS-14 from vertebrate preprosomatostatin gene I having a divergent sequence. The longest form is 37 residues in length (SS-37) and has the sequence ALRAAAVAGSPQQLLPLGQRERKAGCKNFFWKTFSSC. A 34-residue form (SS-34) identical in sequence but truncated at a single Arg residue at position 3 of SS-37 was also isolated. The yields of the three forms were SS-37 (0.43 nmol/g), SS-34 (134 nmol/g), and SS-14 (51.5 nmol/g). The identification of this nested series of somatostatins suggests that prosomatostatin processing in lamprey more closely resembles that observed for procholecystokinin than that of mammalian or other piscine prosomatostatins. Somatostatin-producing cells in the lamprey pancreas were identified by immunostaining using antiserum against SS-34 and anti-serum against mammalian SS-14.