Redirecting the lipid metabolism of the yeast Starmerella bombicola from glycolipid to fatty acid production

Journal of Industrial Microbiology & Biotechnology - Free fatty acids are basic oleochemicals implemented in a range of applications including surfactants, lubricants, paints, plastics, and...     

Crossing boundaries: the importance of cellular membranes in industrial biotechnology

Journal of Industrial Microbiology & Biotechnology - How small molecules cross cellular membranes is an often overlooked issue in an industrial microbiology and biotechnology context. This is...     

Bisphosphonate chelating agents. Coordination ability of 1-phenyl-1-hydroxymethylene bisphosphonate towards Cu(2+) ions

Potentiometric and EPR data allow for evaluation of the coordination equilibria in the Cu(2+)-bisphosphonate system. The bisphosphonic ligand was found very efficient in Cu(2+) chelation with formation of monomeric and dimeric species. Two phosphonate groups are basic binding sites for metal ion. The involvement of hydroxyl in metal ion coordination is also likely, especially when one phosphonate is protected by dimethyl ester. As the metal bound phosphonate groups are relatively bulky (six oxygens) and their negative charge above pH 4 is high (four per ligand) the equimolar species is a dominant complex at physiological pH.     

lamB mutations in E. coli K12: Growth of λ host range mutants and effect of nonsense suppressors

Summary Over sixty EMS induced mutations affecting gene lamB, presumably the structural gene for the receptor in Escherichia coli K12, were examined for growth of host range mutants and effect of nonsense suppressors. By the first criterion the mutations could be grouped in three classes. Bacteria with class I mutations allow growth of mutants with extended host range (noted h) of the type already described (Appleyard, Mac Gregor and Baird, 1956). Bacteria with class II mutations allow growth of h mutants with still more extended host range (noted hh ^*). No host range mutants of could be found which would grow on bacteria with class III mutations. Using nonsense suppressors it was found that class I and II consist of missense mutations, while class III consists of nonsense mutations. Exceptions are likely to exist (especially in class III) but were not found among the mutations tested. These observations are briefly discussed in terms of outer membrane protein integration and of phage receptor interaction.     

Coordination abilities of N-terminal fragments of alpha-synuclein towards copper(II) ions: a combined potentiometric and spectroscopic study

Copper(II) complexes of the 1-17 (MDVFMKGLSKAKEGVVA-NH(2)), 1-28 (MDVFMKGLSKAKEGVVAAAEKTKQGVAE-NH(2)), 1-39 (MDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLY-NH(2)) and 1-39 (A30P) fragments of alpha-synuclein were studied by potentiometric, UV-Vis (UV-visible), CD (circular dichroism) and EPR (electron paramagnetic resonance) spectroscopic methods to determine the stoichiometry, stability constants and coordination modes of the complexes formed. The beta-carboxylate group of Asp residue in second position of the peptide chain coordinates strongly to Cu(II) ion over the pH range 4-9.5 to give unusually stable 2N complex with {NH(2), N(-), beta-COO(-), H(2)O} coordination mode. At pH above 7 the results suggest the formation of 2N, 3N, 4N complexes (in equatorial plane) and the involvement of the lateral NH(2) group of Lys residue in the axial coordination of Cu(II) ion. In CD spectra sigma (epsilon-NH(2)-Lys)-->Cu(II) charge transfer transition is observed. Addition of the 18-28 and 18-39 fragments to the 1-17 peptide does not change the coordination mode and the 1-39 fragment forms the Cu(II) complexes with higher stabilities compared to those of the 1-17, 1-28 and 1-39(A30P) fragments of alpha-synuclein.     

Systematic coordination chemistry and cytotoxicity of copper(II) complexes with methyl substituted 4-nitropyridine N-oxides

Three new nitrato copper(II) complexes of dimethyl substituted 4-nitropyridine N-oxide were synthesized and characterized by elemental analysis, magnetic, spectroscopic, thermal and X-ray methods, respectively. They were isolated as trans isomers, mononuclear (μ = 1.70-1.88 BM), five (1-2) and four (3) coordinate species of general formula [Cu(NO₃)₂(H₂O)L₂] where L = 2,3-dimethyl-, 2,5-dimethyl-4-nitropyridine N-oxide and [Cu (NO₃)₂L₂], L = 3,5-dimethyl-4-nitropyridine N-oxide, respectively. The X-ray crystal structure of (1) (L = 2,3-dimethyl-4-nitropyridine N-oxide) was determined. The organic ligands, the complexes and copper hexaqua ion as a reference were tested in vitro on the cytotoxic activity against human cancer cell lines: MCF-7 (breast), SW-707 (colon) and P-388 (murine leukemia). The complexes are relatively strong cytotoxic agents towards P-388 cell line. Comparative analysis was performed for all known copper(II) complexes containing methyl derivatives of the 4-nitropyridine N-oxide on the basis of their composition, structure and cytotoxic activities. To obtain the typical structure for these species (i.e., 4-coordinate mononuclear of the type trans-[Cu(inorganic anion)₂L₂]), two methyl groups must be situated on both sides of nitrogen atom(s) (i.e., NO and NO₂) in the ligand. The biological activity was found to be strongly dependent upon the number of the methyl groups and the type of cell line. The best cytotoxic results were found for the complexes without substituents or with one methyl group. Generally, for all cell lines, the complexation increased cytotoxicity when compared with the free ligands.     

SCA14 mutation V138E leads to partly unfolded PKCγ associated with an exposed C‐terminus,altered kinetics,phosphorylation and enhanced insolubilization

The protein kinase C γ (PKCγ) undergoes multistep activation and participates in various cellular processes in Purkinje cells. Perturbations in its phosphorylation state, conformation or localization can disrupt kinase signalling, such as in spinocerebellar ataxia type 14 (SCA14) that is caused by missense mutations in PRKCG encoding for PKCγ. We previously showed that SCA14 mutations enhance PKCγ membrane translocation upon stimulation owing to an altered protein conformation. As the faster translocation did not result in an increased function, we examined how SCA14 mutations induce this altered conformation of PKCγ and what the consequences of this conformational change are on PKCγ life cycle. Here, we show that SCA14‐related PKCγ‐V138E exhibits an exposed C‐terminus as shown by fluorescence resonance energy transfer‐fluorescence lifetime imaging microscopy in living cells, indicative of its partial unfolding. This conformational change was associated with faster phorbol 12‐myristate 13‐acetate‐induced translocation and accumulation of fully phosphorylated PKCγ in the insoluble fraction, which could be rescued by coexpressing PDK1 kinase that normally triggers PKCγ autophosphorylation. We propose that the SCA14 mutation V138E causes unfolding of the C1B domain and exposure of the C‐terminus of the PKCγ‐V138E molecule, resulting in a decrease of functional kinase in the soluble fraction.

     

Evaluation of results of linac-based radiosurgery for brain metastases from primary lung cancer

Aim

The purpose of our review was to evaluate results of radiosurgery for patients with brain metastases from lung cancer.

Background

Lung cancer is the leading cause of death from cancer and the most common source of brain metastases. Radiosurgery allows the precise focal delivery of a high single radiation dose to brain metastases and results in high rates of local control.

Materials and methods

83 patients were treated between 2006 and 2008. We evaluated local control and outcome after radiosurgery and identified prognostic factors.

Results

Median survival in the whole group was 7.8 months from radiosurgery and 11 months from diagnosis. Median survival in classes I, II and III was 13.2, 8.2 and 2.2 months. For 94% of patients symptoms improved or stabilised at the first follow-up visit and this status did not change during 7.1 months. According to the univariate analysis, factors associated with improved survival included: RPA class 1 compared with RPA 2 and 3, RPA class 2 compared with RPA 3, KPS > 70, control of the primary disease, radiosurgery performed more than once, level of haemoglobin >7 mmol/1, absence of extracranial metastases, volume of the biggest lesion <11 cm³. The multivariate analysis confirmed a significant influence on survival for the following factors: RPA class 1 as compared with RPA 3, KPS > 70, absence of extracranial metastases, multiplicity of radiosurgery.

Conclusions

Stereotactic radiosurgery is a safe and effective treatment. It proved to be effective and safe in older patients. Selection of patients who are likely to benefit most should be based on prognostic factors. KPS proved to be the most important prognostic factor. In the RPA III group (patients with KPS < 70) survival time was similar to that achieved after symptomatic medical management.