The stoichiometry and energetics of oxygenic phototrophic growth

The values of gross metabolic flows in cells are essentially interconnected due to conservation laws of chemical elements and interrelations of biochemical coupling. Therefore, the overall stoichiometry of cellular metabolism, such as the biomass quantum yield, the ratio between linear and circular flows via the electron transport chain, etc., can be calculated using balances of metabolic flows in the network branching points and coupling ratios related to ATP formation and expenditures. This work has studied the energetic stoichiometry of photosynthetic cells by considering the transfer of reductivity in the course of biochemical reactions. This approach yielded rigorous mathematical expressions for biomass quantum yield and other integral bioenergetic indices of cellular growth as functions of ATP balance parameters. The effect of cellular substance turnover has been taken into account. The obtained theoretical estimation of biomass quantum yield is rather close to experimental data which confirms the predictive capacity of this approach.     

Physiological Stress in Koala Populations near the Arid Edge of Their Distribution

Recent research has shown that the ecology of stress has hitherto been neglected, but it is in fact an important influence on the distribution and numbers of wild vertebrates. Environmental changes have the potential to cause physiological stress that can affect population dynamics. Detailed information on the influence of environmental variables on glucocorticoid levels (a measure of stress) at the trailing edge of a species’ distribution can highlight stressors that potentially threaten species and thereby help explain how environmental challenges, such as climate change, will affect the survival of these populations. Rainfall determines leaf moisture and/or nutritional content, which in turn impacts on cortisol concentrations. We show that higher faecal cortisol metabolite (FCM) levels in koala populations at the trailing arid edge of their range in southwestern Queensland are associated with lower rainfall levels (especially rainfall from the previous two months), indicating an increase in physiological stress when moisture levels are low. These results show that koalas at the semi-arid, inland edge of their geographic range, will fail to cope with increasing aridity from climate change. The results demonstrate the importance of integrating physiological assessments into ecological studies to identify stressors that have the potential to compromise the long-term survival of threatened species. This finding points to the need for research to link these stressors to demographic decline to ensure a more comprehensive understanding of species’ responses to climate change.     

Six new deep-water sternaspid species (Annelida,Sternaspidae) from the Pacific Ocean

Most sternaspid species have been described from shallow water, and Caulleryaspis Sendall & Salazar-Vallejo, 2013 includes one deep water species: C. gudmundssoni Sendall & Salazar-Vallejo, 2013 from Iceland. In Sternaspis Otto, 1821, the most speciose genus, most species were described from shallow water and only three thrive in deep water: S. maior Chamberlin, 1919 from the Gulf of California, S. princeps Selenka, 1885 from New Zealand, and S. riestchi Caullery, 1944 from Indonesia. The study of some deep sea sternaspids from the Pacific Ocean in the collections of six research institutions resulted in the discovery of six undescribed species, and for three of them there were abundant materials showing ventro-caudal shield development. Caulleryaspis fauchaldi sp. n. is described based on specimens from Oregon and California; it differs from the known species because it has a shield with rounded anterior margins and its peg chaetae form thin, small spines. Caulleryaspis nuda sp. n. was collected off Oregon; it is unique because its shield lacks a layer of sediment particles firmly attached, but has instead a thin layer of small particles loosely attached. Four other species are newly described in Sternaspis: S. annenkovae sp. n. was collected east off the northern Kurile Islands in about 4,000 m depth; it differs from other species by having a bicolored body, with the introvert darker than the abdomen, and its ventro-caudal shield plates are divergent resulting in a divided fan. The second species, S. maureri sp. n. was found off Peru in 1296–6489 m water depths and in the Southwestern Pacific in 795–3830 m; it resembles S. williamsae sp. n. but differs because its shield has better-developed ribs, the fan has a shallow or indistinct median notch and has lateral notches well-developed. The third species, S. uschakovi sp. n., was found in the Okhotsk Sea in 592–1366 m, off California in 1585 m, Gulf of California in 1200–1274 m, and Western Mexico in 2548 m; it resembles S. africana Augener, 1918 and S. andamanensis Sendall & Salazar-Vallejo, 2013 in having shields with a denticulate posterior margin; the latter two species live in shallow water and they differ from each other and from the new species by a combination of shield and papillae features. The fourth species, S. williamsae sp. n., was found off Oregon in 1000–2400 m, and off California in 878–1246 m; it resembles S. annenkovae because both species have shields with fans narrower than the anterior margin width, but differ in the relative development of shield features and in the relative size of prostomium and mouth; as stated above it also resembles S. maureri sp. n. but its shield has poorly-developed ribs, its median notch is distinct, and the lateral notches are poorly developed or indistinct. Keys to identify all species of Caulleryaspis and Sternaspis are also included.     

Mobility of acetylcholine receptors in command Helix lucorum neurons in a cellular analog of habituation

We investigated the role of the mobility of acetylcholine receptors in the depression of an acetylcholine-induced inward current (ACh-current) of Helix lucorum (a land snail) command neurons of defensive behavior in a cellular analog of habituation. The inhibitors of endocytosis and exocytosis, actin microfilaments and cytoskeleton microtubules, serine/threonine protein kinases (PKA, PKG, calcium calmodulin-dependent PK II, p38 mitogen-activated PK), tyrosine kinases (including Src-family kinases), serine/threonine phosphatases (PP1, PP2A, PP2B, PPM1D), and tyrosine protein phosphatases altered the depression of the ACh-current. A comparison of experimentally calculated curves of the ACh-current of these neurons and those obtained by mathematical modeling revealed the following: (a) ACh-current depression is caused by the reduction in the number of membranous ACh-receptors, which results from the shift in the balance of multidirectional transport processes of receptors toward the predominance of ACh-receptor internalization over their recycling; (b) depression of ACh-current depends on the activity of serine/threonine and tyrosine protein kinases and protein phosphatases, whose one of the main targets is the neuron transport system—actin microfilaments and microtubules of cytoskeleton, as well as motor proteins.     

A Novel Intergenic ETnII-β Insertion Mutation Causes Multiple Malformations in Polypodia Mice

Mouse early transposon insertions are responsible for ∼10% of spontaneous mutant phenotypes. We previously reported the phenotypes and genetic mapping of Polypodia, (Ppd), a spontaneous, X-linked dominant mutation with profound effects on body plan morphogenesis. Our new data shows that mutant mice are not born in expected Mendelian ratios secondary to loss after E9.5. In addition, we refined the Ppd genetic interval and discovered a novel ETnII-β early transposon insertion between the genes for Dusp9 and Pnck. The ETn inserted 1.6 kb downstream and antisense to Dusp9 and does not disrupt polyadenylation or splicing of either gene. Knock-in mice engineered to carry the ETn display Ppd characteristic ectopic caudal limb phenotypes, showing that the ETn insertion is the Ppd molecular lesion. Early transposons are actively expressed in the early blastocyst. To explore the consequences of the ETn on the genomic landscape at an early stage of development, we compared interval gene expression between wild-type and mutant ES cells. Mutant ES cell expression analysis revealed marked upregulation of Dusp9 mRNA and protein expression. Evaluation of the 5′ LTR CpG methylation state in adult mice revealed no correlation with the occurrence or severity of Ppd phenotypes at birth. Thus, the broad range of phenotypes observed in this mutant is secondary to a novel intergenic ETn insertion whose effects include dysregulation of nearby interval gene expression at early stages of development.     

Long-Term Space Flight Simulation Reveals Infradian Rhythmicity in Human Na+ Balance

1. Download : Download high-res image (368KB)
2. Download : Download full-size image

Highlights? Increased salt intake lowers urinary aldosterone but increases cortisol excretion ? At constant salt intake, urinary Na⁺ excretion exhibits a circaseptan pattern ? Total body Na⁺ exhibits a far-longer infradian rhythm, not related to body water ? Na⁺ can be stored in the body independent of water or blood pressure     

Antioxidant Properties of Galanin and Its N-Terminal Fragments in in vitro and in vivo Oxidative Stress Modeling

Biochemistry (Moscow) - Antioxidant properties of rat galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (Gal), N-terminal fragment of galanin (2-15 aa) WTLNSAGYLLGPHA (G1), and its modified analogue...     

Effects of extracellular DNA on plasminogen activation and fibrinolysis

The increased levels of extracellular DNA found in a number of disorders involving dysregulation of the fibrinolytic system may affect interactions between fibrinolytic enzymes and inhibitors. Double-stranded (ds) DNA and oligonucleotides bind tissue-(tPA) and urokinase (uPA)-type plasminogen activators, plasmin, and plasminogen with submicromolar affinity. The binding of enzymes to DNA was detected by EMSA, steady-state, and stopped-flow fluorimetry. The interaction of dsDNA/oligonucleotides with tPA and uPA includes a fast bimolecular step, followed by two monomolecular steps, likely indicating slow conformational changes in the enzyme. DNA (0.1-5.0 μg/ml), but not RNA, potentiates the activation of Glu- and Lys-plasminogen by tPA and uPA by 480- and 70-fold and 10.7- and 17-fold, respectively, via a template mechanism similar to that known for fibrin. However, unlike fibrin, dsDNA/oligonucleotides moderately affect the reaction between plasmin and α(2)-antiplasmin and accelerate the inactivation of tPA and two chain uPA by plasminogen activator inhibitor-1 (PAI-1), which is potentiated by vitronectin. dsDNA (0.1-1.0 μg/ml) does not affect the rate of fibrinolysis by plasmin but increases by 4-5-fold the rate of fibrinolysis by Glu-plasminogen/plasminogen activator. The presence of α(2)-antiplasmin abolishes the potentiation of fibrinolysis by dsDNA. At higher concentrations (1.0-20 μg/ml), dsDNA competes for plasmin with fibrin and decreases the rate of fibrinolysis. dsDNA/oligonucleotides incorporated into a fibrin film also inhibit fibrinolysis. Thus, extracellular DNA at physiological concentrations may potentiate fibrinolysis by stimulating fibrin-independent plasminogen activation. Conversely, DNA could inhibit fibrinolysis by increasing the susceptibility of fibrinolytic enzymes to serpins.