共查询到20条相似文献,搜索用时 31 毫秒
1.
A. M. Castillo L. Cistué M. P. Vallés J. M. Sanz I. Romagosa J. L. Molina-Cano 《Plant cell reports》2001,20(2):105-111
The aim of this study was to establish a protocol for an efficient production of agronomical and/or physiological mutants
from model (cvs. Igri and Cobra) and low-androgenic-responding (cv. Volga) cultivars of barley through the application of
a mutagenic agent, sodium azide, to anthers and isolated microspores cultured in vitro. This technology offers the possibilities of screening for recessive mutants in the first generation, selecting for novel
genotypes from very large haploid populations, avoiding chimerism and rapidly fixing selected genotypes as fertile true breeding
lines. The mutagenic treatment, 10–3–10–5
M sodium azide, was applied during the anther induction pre-treatment or immediately after the microspore isolation procedure.
Out of 616 M2 doubled-haploid lines characterised under field conditions, a total of 63 morphological and developmental independent mutant
lines were identified. The percentage of M2 doubled-haploid lines carrying mutations per line analysed was 3.8% when 10–4
M sodium azide was applied to anthers from the low-responding cv. Volga; this increased to 8.6% and 15.6% when 10–5 and 10–4
M sodium azide were applied to freshly isolated microspores from model cultivars.
Received: 18 April 2000 / Revision received: 28 September 2000 / Accepted: 28 September 2000 相似文献
2.
Ebanks R Dupont M Shareck F Morosoli R Kluepfel D Dupont C 《Journal of industrial microbiology & biotechnology》2000,25(6):310-314
A thermostability screening assay was developed using an Escherichia coli expression system to express Streptomyces lividans xylanase A (XlnA). The screening system was tested using mutants randomized at position 49 of the S. lividans XlnA gene, a position previously shown to confer thermostability with a I49P point mutation. The library was cloned into
an E. coli expression vector and transformed into XL1-blue bacteria. The resulting clones were screened for increased thermostability
with respect to wild-type XlnA. Using this assay, we isolated the I49P mutant previously shown to be thermostable, as well
as novel I49A and I49C mutants. The I49A and I49C mutants were shown to have 2.8- to 8-fold increase in thermostability over
that of wild-type XlnA. The results show that the screening assay can selectively enrich for clones with increased thermostability
and is suitable for screening small- to medium-sized libraries of 5000–20,000 clones. Journal of Industrial Microbiology & Biotechnology (2000) 25, 310–314.
Received 18 May 2000/ Accepted in revised form 19 September 2000 相似文献
3.
Cell-free preparations of Tetrahymena thermophila catalyze the direct desaturation of cholesterol to Δ7-dehydrocholesterol (provitamin D3). The activity was isolated in the microsomal fraction from Tetrahymena homogenates. Δ7-Desaturase activity was stimulated fivefold by the addition of 6 mM ATP. Other cofactors assayed, including NAD, NADP, NADH
or NADPH, had no significant effect. The activity was found in microsomes prepared from stationary-phase cultures of the ciliate,
grown either with or without added cholesterol, thus indicating that it is constitutively expressed in T. thermophila cells.
Received: 17 May 1999 / Accepted: 24 September 1999 相似文献
4.
John M. Uscian David W. Stanley-Samuelson 《Archives of insect biochemistry and physiology》1993,24(4):187-201
We report on phospholipase A2 (PLA2) activity in homogenates prepared from fat bodies of the tobacco hornworm Manduca sexta. PLA2 activity is responsible for hydrolyzing fatty acids from the sn-2 position of phospholipids. The rate of hydrolysis increased with increasing homogenate protein concentration up to ~? 320 μg protein/ml reaction volume. Higher protein concentrations did not appreciably increase the rate of PLA2 activity. As seen in some, but not all PLA2s from mammalian sources, hydrolyzing activity increased linearly with time. The fat body activity was sensitive to pH (optimal activity at pH 8–9) and temperature (optimal activity at ~?40°C). The activity was associated with fat body rather than hemolymph, because no activity was detected in cell-free serum. The fat body PLA2 activity differs from the majority of PLA2s with respect to calcium requirements. Whereas most PLA2s are calcium-independent. A few others are known to require submicromolar calcium concentrations. The fat body activity appears to be calcium independent. These data show that a PLA2 activity that can hydrolyze arachidonic acid from the sn-2 position of phospholipids is associated with the tobacco hornworm fat body. The biological significance of this activity relates to biosynthesis of eicosanoids. Pharmacological inhibition of PLA2 impairs the ability of this insect to respond to bacterial infections. Since the impairment can be reversed by treatment with exogenous arachidonic acid, the PLA2 activity may be an important step in eicosanoid biosynthesis. © 1993 Wiley-Liss, Inc. 相似文献
5.
J De Coninck I Verdier-Denantes F Duyme S Bouquelet V Dumortier 《Journal of industrial microbiology & biotechnology》2000,25(1):58-61
Oxygen concentrations stimulated growth (maximum number of cells) and protease secretion by Tetrahymena thermophila. Agitation and aeration conditions for growth and protease secretion were optimised by a central composite design. The best
optimised combination was a stirrer speed of 338 rpm and an aeration of 1 vvm. Journal of Industrial Microbiology & Biotechnology (2000) 25, 58–61.
Received 24 September 1999/ Accepted in revised form 06 March 2000 相似文献
6.
Certain COOH-terminus mutants of connexin32 (Cx32) were previously shown to form channels with unusual transjuctional voltage
(V
j
) sensitivity when tested heterotypically in oocytes against Cx32 wild type. Junctional conductance (G
j
) slowly increased by severalfold or decreases to nearly zero with V
j
positive or negative, respectively, at mutant side, and V
j
positive at mutant side reversed CO2-induced uncoupling. This suggested that the CO2-sensitive gate might be a V
j
-sensitive slow gate. Based on previous data for calmodulin (CaM) involvement in gap junction function, we have hypothesized
that the slow gate could be a CaM-like pore plugging molecule (cork gating model). This study describes a similar behavior
in heterotypic channels between Cx32 and each of four new Cx32 mutants modified in cytoplasmic-loop and/or COOH-terminus residues.
The mutants are: ML/NN+3R/N, 3R/N, ML/NN and ML/EE; in these mutants, N or E replace M105 and L106, and N replace R215, R219
and R220. This study also reports that inhibition of CaM expression strongly reduces V
j
and CO2 sensitivities of two of the most effective mutants, suggesting a CaM role in slow and chemical gating.
Received: 19 April 2000/Revised: 11 August 2000 相似文献
7.
Kishimura H Ojima T Hayashi K Nishita K 《Comparative biochemistry and physiology. Part B, Biochemistry & molecular biology》2000,126(4):579-586
Three cDNA from the pyloric ceca of the starfish Asterina pectinifera, (namely, cDNA 1, 2, and 3), encoding phospholipase A2 (PLA2), were isolated and sequenced. These cDNAs were composed of 415 bp with an open reading frame of 414 bp at nucleotide positions 1–414, which encodes 138 amino acids including N-terminal Met derived from the PCR primer. The amino acid sequence deduced from the cDNA 1 was completely consistent with the sequence determined with the starfish PLA2 protein, while those deduced from cDNA 2 and cDNA 3 differed at one and twelve amino acid residual positions, respectively, from the sequence of the PLA2 protein, suggesting the presence of multiple forms in the starfish PLA2. All of the sequences deduced from cDNA 1, 2, and 3 required two amino acid deletions in pancreatic loop region, and sixteen insertions and three deletions in β-wing region when aligned with the sequence of mammalian pancreatic PLA2. In phylogenetic tree, the starfish PLA2 should be classified into an independent group, but hardly to the established groups IA and IB. The characteristic structure in the pancreatic loop and β-wing regions may account for the specific properties of the starfish PLA2, e.g. the higher activity and characteristic substrate specificity compared with commercially available PLA2 from porcine pancreas. 相似文献
8.
M. N. Shuaibu H. Kanbara T. Yanagi D. A. Ameh J. J. Bonire A. J. Nok 《Journal of enzyme inhibition and medicinal chemistry》2013,28(5):433-441
Activity and kinetics of phospholipase A2 (PLA2) from Trypanosoma brucei gambiense (Wellcome strain) and Trypanosoma brucei brucei (GUTat 3.1) were examined using two different fluorescent substrates. The activity in the supernatants of sonicated parasites was Ca2+-independent, strongly stimulated by Triton X-100 with optimum activity at 37°C and pH 6.5–8.5. To encourage a possible interaction between the parasite enzyme and organotin compounds, fatty acid derivatives of dibutyltin dichloride were synthesized and evaluated as potential inhibitors of PLA2. The enzyme from the two-trypanosome species differ with respect to kinetic parameters and are noncompetitively inhibited by the organotin compounds. The Michaelis constant (KM) for PLA2 from T. b. brucei is 63.87 and 30.90 μM while for T. b. gambiense it is 119.64 and 32.90 μM for the substrates l,2-bis-(1-pyrenebutanoyl-sn-glycero-3-phosphocholine (PBGPC) and 2-(12-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)amino)dode-canoyl-1-hexadecanoyl-sn-glycero-3-phosphocholine (NBDC12-HPC), respectively. 相似文献
9.
M. V. Gonchar L. B. Kostryk A. A. Sibirny 《Applied microbiology and biotechnology》1997,48(4):454-458
Mutant strains of the methylotrophic yeast Hansenula polymorpha defective in catalase (cat) and in glucose repression of alcohol oxidase synthesis (gcr1) have been isolated following multiple UV mutagenesis steps. One representative gcr1 cat mutant C-105 grows during batch cultivation in a glucose/methanol medium. However, growth is preceded by a prolonged lag
period. C-105 and other gcr1 cat mutants do not grow on methanol medium without an alternative carbon source. A large collection of second-site suppressor
catalase-defective (scd) revertants were isolated with restored ability for methylotrophic growth (Mth+) in the absence of catalase activity. These Mth+
gcr1 cat scd strains utilize methanol as a sole source of carbon and energy, although biomass yields are reduced relative to the wild-type
strain. In contrast to the parental C-105 strain, H2O2 does not accumulate in the methanol medium of the revertants. We show that restoration of methylotrophic growth in the suppressor
strains is strongly correlated with increased levels of the alternative H2O2-destroying enzyme, cytochrome c peroxidase. Cytochrome c peroxidase from cell-free extracts of one of the scd revertants has been purified to homogeneity and crystallized.
Received: 9 December 1996 / Received revision: 5 May 1997 / Accepted: 25 May 1997 相似文献
10.
Belo CA Toyama MH Toyama Dde O Marangoni S Moreno FB Cavada BS Fontana MD Hyslop S Carneiro EM Boschero AC 《The protein journal》2005,24(3):147-153
A new Phospholipase A2 (PLA2) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA2 showed a low enzymatic activity when compared with other PLA2s and it is moderately basic with an isoelectric point of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSYDCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA2s, such as Naja naja, showed significant differences in the β-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA2, supporting the view that other regions of the protein are involved in the biological effects. 相似文献
11.
Kofler H Häusler RE Schulz B Gröner F Flügge UI Weber A 《Molecular & general genetics : MGG》2000,263(6):978-986
Screening of transposon-associated mutants of Arabidopsis thaliana for altered starch metabolism resulted in the isolation of a mutant that did not accumulate starch in any tissue or at any
developmental stage (starch-free mutant, stf1). Allelism tests with known mutants showed that stf1 represents a new mutant allele of the plastid isoform of the enzyme phosphoglucomutase (PGMp). The mutation was mapped to
chromosome 5. An Arabidopsis EST that showed significant homology to the cytosolic isoform of phosphoglucomutase (PGM) from maize was able to complement
the mutant phenotype. The Arabidopsis EST was transcribed and translated in vitro and the protein product was efficiently imported into isolated chloroplasts and
processed to its mature form. The lack of starch biosynthesis in stf1 is accompanied by the accumulation of soluble sugars. The rate of CO2 assimilation measured in individual leaves was substantially diminished only under conditions of high CO2 and low O2. Remarkably, stf1 exhibits an increase rather than a decrease in total leaf PGM activity, suggesting an induction of the cytosolic isoform(s)
in the mutant. The substrate for PGM, glucose 6-phosphate, accumulated in stf1 during the day, resulting in 10-fold higher content than in the wild type at the end of the photoperiod.
Received: 4 January 2000 / Accepted: 21 March 2000 相似文献
12.
Interisland Evolution of <Emphasis Type="Italic">Trimeresurus flavoviridis</Emphasis> Venom Phospholipase A<Subscript>2</Subscript> Isozymes 总被引:1,自引:0,他引:1
Chijiwa T Yamaguchi Y Ogawa T Deshimaru M Nobuhisa I Nakashima K Oda-Ueda N Fukumaki Y Hattori S Ohno M 《Journal of molecular evolution》2003,56(3):286-293
Abstract
Trimeresurus flavoviridis snakes inhabit the southwestern islands of Japan. A phospholipase A2 (PLA2), named PL-Y, was isolated from Okinawa T. flavoviridis venom and its amino acid sequence was determined from both protein and cDNA. PL-Y was unable to induce edema. In contrast,
PLA-B, a PLA2 from Tokunoshima T. flavoviridis venom, which is different at only three positions from PL-Y, is known to induce edema. A new PLA2, named PLA-B′, which is similar to PLA-B, was cloned from Amami-Oshima T. flavoviridis venom gland. Three T. flavoviridis venom basic [Asp49]PLA2 isozymes, PL-Y (Okinawa), PLA-B (Tokunoshima), and PLA-B′ (Amami-Oshima), are identical in the N-terminal half but have one
to four amino acid substitutions in the β1-sheet and its vicinity. Such interisland sequence diversities among them are due
to isolation in the different environments over 1 to 2 million years and appear to have been brought about by natural selection
for point mutation in their genes. Otherwise, a major PLA2, named PLA2, ubiquitously exists in the venoms of T. flavoviridis snakes from the three islands with one to three synonymous substitutions in their cDNAs. It is assumed that the PLA2 gene
is a prototype among T. flavoviridis venom PLA2 isozyme genes and has hardly undergone nonsynonymous mutation as a principal toxic component. Phylogenetic analysis based
on the amino acid sequences revealed that T. flavoviridis PLA2 isozymes are clearly separated into three groups, PLA2 type, basic [Asp49]PLA2 type, and [Lys49]PLA2 type. Basic [Asp49]PLA2-type isozymes may manifest their own particular toxic functions different from those of the isozymes of the PLA2 type and
[Lys49]PLA2 type. 相似文献
13.
Yoshida T Horinouchi M Ayabe Y Yamaguchi T Shibuya N Habe H Nojiri H Yamane H Omori T 《Applied microbiology and biotechnology》2000,54(3):341-347
A CH3OH-utilizing bacterium that has the ability to produce extracellular polysaccharide (EPS) was isolated from a soil sample,
and was identified as the obligate methylotroph Methylobacillus sp. strain 12S on the basis of its 16S rDNA sequence and growth-substrate specificity. The EPS produced by strain 12S was
purified and the sugar composition was analysed by GC-MS and HPLC to reveal that the EPS was a heteropolymer composed of glucosyl,
galactosyl, and mannosyl residues in the molar ratio 3:1:1. In order to produce mono- and/or oligosaccharides by single-step
fermentation from CH3OH, stain 12S was mutagenized by transposon 5. Among eleven EPS-deficient mutants, three strains were found to accumulate significant amounts of reducing sugars in the
media. The amounts of the reducing sugars produced by the mutants (>ca. 700 mg glucose equivalent/l) were >11–22 times higher
than those produced by the wild-type strain (<ca. 60 mg glucose equivalent/l). The GC-MS analysis showed that all the mutants
accumulated glucose, erythrose, threose and a disaccharide-like compound in the media.
Received: 25 August 1999 / Received revision: 15 March 2000 / Accepted: 24 March 2000 相似文献
14.
Isolation and characterization of nitrite-reductase-deficient mutants of Chlorella sorokiniana (strain 211-8k) 总被引:1,自引:0,他引:1
A method is presented to isolate mutants of Chlorella sorokiniana with defects in NO3
− metabolism. Three nitrite-reductase (NIR; E.C.1.7.7.1)-deficient mutants were obtained from 500 pinpoint-colony-forming clones.
The final screening was performed using NO3
−, NO2
− or NH+
4 as N-source. The mutants isolated absorb NO3
− with rates close to those measured for the wild type and they excrete NO2
− into the medium. The ratio between NO3
− uptake and NO2
− excretion was 1:1. The sensitivity of NO3
− uptake to NH+
4 was reduced in the mutant strains as it was in the N-starved wild type of Chlorella. Nitrate reductase (NR; EC 1.6.6.1) expression and NR activity were slightly reduced compared to the wild type due to feedback
regulation in the mutant strains. No NIR protein was found in the three mutants. However, NIR activity was obtained (50% of
the wild-type) for one mutant strain. The NIR-deficient mutants and the already available NR-deficient mutants will be promising
tools for investigations of the nitrate assimilation pathway on the molecular level and for studies searching for signaling
of C and N metabolism by inorganic N-compounds.
Received: 8 October 1999 / Accepted: 25 January 2000 相似文献
15.
Cr 5 PLA2 homologous (K49) was isolated from Calloselasma rhodostoma venom in only one chromatographic step in reverse phase HPLC (RP-HPLC) (on μ-Bondapack C-18). A molecular mass of 13.965 Da was determined by MALDI-TOF mass spectrometry. The amino acid composition showed that Cr 5 had a high content of Lys, Tyr, Gly, Pro, and 14 half-Cys residues, typical residues of a basic PLA2. The complete amino acid sequence of Cr 5 PLA2 contains 120 residues, resulting in a calculated pI value of 5.55. This sequence shows high identity values when compared to other K49 PLA2s isolated from the venoms of viperid snakes. Lower identity is observed in comparison to D49 PLA2s. The sequence found was SLVELGKMIL QETGKNPAKS YGAYGCNCGV LGRHKPKDAT DRCCFVHKCC YKKLTGCDPK KDRYSYSWKD KTIVCGENNP CLKEMCECDK AVAICLRENL DTYNKKYRYL KPFCKKADDC. In mice, Cr 5 induced myonecrosis and edema upon intramuscular and intravenous injections, respectively. The LD50 of Cr 5 was 0.070 mg/kg of the animal weight, by intracerebroventricular (i.c.v.) route. In vitro, the toxin caused rapid cytolytic effect upon mouse skeletal muscle myoblasts in culture. The isolation of this PLA2 and the combined structural and functional information obtained classify Cr 5 as a new member of the K49 PLA2 family, since it presents typical features from such proteins. 相似文献
16.
J. Miranda J. Membrillo-Hernández M. L. Tabche M. Soberón 《Applied microbiology and biotechnology》1996,45(1-2):182-188
A method to isolate mutants with derepressed expression of cytochrome oxidases and better symbiotic performance is presented.
A mutant of Rhizobium etli, CFN030, isolated by its azide-resistant phenotype, was obtained by transposon Tn5-mob mutagenesis. This mutant has a derepressed expression of cytochrome aa3, higher respiratory activities when cultured microaerobically and an improved symbiotic nitrogen fixation capacity. This
phenotype was similar to the previously described mutant CFN037, which was isolated by its increased capacity to oxidize N,N,N′,N′-tetramethyl-p-phenylenediamine (TMPD) [Soberón M et al. (1990) J Bacteriol 172:1676–1680]. We show here that although both mutants have
a similar symbiotic phenotype, they are affected in different genes. Strain CFN030 has the Tn5 inserted in the chromosome while in strain CFN037 the transposon was located in plasmid b. Cytochrome spectral analysis of
both mutant strains in the post-exponential phase of growth, showed the expression of an additional terminal oxidase (cbb3) that is not expressed in the wild-type strain.
Received: 10 April 1995/Received revision: 21 August 1995/Accepted: 7 September1995 相似文献
17.
Elliott R. Baker John J. A. McLaughlin Seymour H. Hutner Barbara DeAngelis Susan Feingold Oscar Frank Herman Baker 《Archives of microbiology》1981,129(4):310-313
Vitamins B6 and B12, biotin, folates, riboflavin, nicotinate, pantothenate, biopterin, and vitamin C (l-ascorbate) were assayed in Poteriochromonas stipitata, Euglena gracilis, and Tetrahymena thermophila cells grown in defined media and in spent culture supernatants. P. stipitata and E. gracilis synthesized, stored and excreted folates (mainly as 5-methyltetrahydrofolate), B6, riboflavin, pantothenate, nicotinate, biopterin, and ascorbate. E. gracilis synthesized and stored biotin. T. thermophila did not synthesize the above vitamins except for B12, biopterin, and ascorbate; it excreted biopterin and stored B12 and ascorbate. Thiamin was left of consideration because all 3 organisms are thiamin auxotrophs. Possible ecological implications of these findings are considered. 相似文献
18.
Alan S. Bowman Jack W. Dillwith Robin D. Madden John R. Sauer 《Archives of insect biochemistry and physiology》1995,29(3):309-327
An important regulatory step for prostaglandin synthesis is the availability of the precursor, free arachidonic acid (AA). In isolated salivary glands of the lone star tick, Amblyomma americanum (L.), the level of free AA appears to depend on higher phospholipase A2 (PLA2) activity rather than decreased rates of re-esterification by lysophosphatide acyl transferase (LAT). This conclusion is supported by experiments where inhibition of LAT with merthiolate was without effect, while the calcium ionophore A23187, a PLA2 stimulant, increased levels of free AA. The PLA2 activity in A. americanum was reduced by the substrate analog, PLA2 inhibitor, oleyloxyethyl phosphorylcholine in a dose-dependent manner, but was insensitive to the other mammalian PLA2 inhibitors mepacrine (20μM), aristolochic acid (45μM), and dexamethasone (50μM). No substrate preference was observed for the functional group of the phospholipid, with phosphatidylcholine and phosphatidylethanolamine being equal sources of AA in A23187-stimulated glands. Compared to phospholipids containing other fatty acids, only arachidonyl-phospholipid (arachidonyl-PL) was significantly hydrolyzed by PLA2 activity in A23187-stimulated glands. Dopamine was as effective as A23187 as a stimulant of PLA2 activity in isolated glands, but this effect was abolished in the presence of the calcium channel blocking agent verapamil. It is concluded that free AA levels in tick salivary glands are increased through activation of a Type IV-like PLA2 following an increase of intracellular calcium caused by the opening of voltage-dependent calcium channels due to dopamine stimulation. © 1995 Wiley-Liss, Inc. 相似文献
19.
A method for solid-phase detection of phospholipase A2 (PLA2) was developed. The method uses 1-octanoyloxynaphthalene-3-sulfonic acid, which was found to be a good substrate of PLA2. The substrate is hydrolyzed by PLA2 into 1-naphthol-3-sulfonic acid, which is spontaneously coupled with coexisting diazonium salt to form a red-purple azo dye. Streptomyces and bovine pancreatic PLA2 spotted on a nitrocellulose membrane could be detected by this method with considerable sensitivity. In addition, colonies of recombinant Escherichia coli producing bacterial PLA2 were distinguishable from those producing an inactive mutant PLA2, facilitating high-throughput screening in directed evolution of the enzyme. 相似文献
20.
The electron donor (component B) to the methyl coenzyme M methylreductase system from Methanosarcina thermophila was isolated as the 7-methyl derivative and characterized. Gas chromatography-mass spectrometry and 1H NMR analyses identified this derivative as 7-methylthioheptanoylthreonine phosphate (CH3-S-HTP), indicating that the original component B had the same structure (HS-HTP) as previously determined for component B from Methanobacterium thermoautotrophicum. The heterodisulfide of HS-HTP and coenzyme M (HS-CoM, 2-mercaptoethanesulfonate) was enzymatically reduced in cell extracts using electrons supplied by either H2 or CO, confirming that HS-HTP was a functional molecule in M. thermophila. 相似文献