首页 | 本学科首页   官方微博 | 高级检索  
相似文献
 共查询到20条相似文献,搜索用时 125 毫秒
1.
Mesenchymal stem cells (MSC) are adult-derived multipotent stem cells that have been derived from almost every tissue. They are classically defined as spindle-shaped, plastic-adherent cells capable of adipogenic, chondrogenic, and osteogenic differentiation. This capacity for trilineage differentiation has been the foundation for research into the use of MSC to regenerate damaged tissues. Recent studies have shown that MSC interact with cells of the immune system and modulate their function. Although many of the details underlying the mechanisms by which MSC modulate the immune system have been defined for human and rodent (mouse and rat) MSC, much less is known about MSC from other veterinary species. This knowledge gap is particularly important because the clinical use of MSC in veterinary medicine is increasing and far exceeds the use of MSC in human medicine. It is crucial to determine how MSC modulate the immune system for each animal species as well as for MSC derived from any given tissue source. A comparative approach provides a unique translational opportunity to bring novel cell-based therapies to the veterinary market as well as enhance the utility of animal models for human disorders. The current review covers what is currently known about MSC and their immunomodulatory functions in veterinary species, excluding laboratory rodents.Abbreviations: AT, adipose tissue; BM, Bone marrow; CB, umbilical cord blood; CT, umbilical cord tissue; DC, dendritic cell; IDO, indoleamine 2;3-dioxygenase; MSC, mesenchymal stem cells; PGE2, prostaglandin E2; VEGF, vascular endothelial growth factorMesenchymal stem cells (MSC, alternatively known as mesenchymal stromal cells) were first reported in the literature in 1968.39 MSC are thought to be of pericyte origin (cells that line the vasculature)21,22 and typically are isolated from highly vascular tissues. In humans and mice, MSC have been isolated from fat, placental tissues (placenta, Wharton jelly, umbilical cord, umbilical cord blood), hair follicles, tendon, synovial membrane, periodontal ligament, and every major organ (brain, spleen, liver, kidney, lung, bone marrow, muscle, thymus, pancreas, skin).23,121 For most current clinical applications, MSC are isolated from adipose tissue (AT), bone marrow (BM), umbilical cord blood (CB), and umbilical cord tissue (CT; 11,87,99 Clinical trials in human medicine focus on the use of MSC both for their antiinflammatory properties (graft-versus-host disease, irritable bowel syndrome) and their ability to aid in tissue and bone regeneration in combination with growth factors and bone scaffolds (clinicaltrials.gov).131 For tissue regeneration, the abilities of MSC to differentiate and to secrete mediators and interact with cells of the immune system likely contribute to tissue healing (Figure 1). The current review will not address the specific use of MSC for orthopedic applications and tissue regeneration, although the topic is covered widely in current literature for both human and veterinary medicine.57,62,90

Table 1.

Tissues from which MSC have been isolated
Tissue source (reference no.)
SpeciesFatBone marrowCord bloodCord tissueOther
Cat1348356
Chicken63
Cow13812108
Dog973, 5978, 119139Periodontal ligament65
Goat66964
Horse26, 13037, 40, 12367130Periodontal ligament and gingiva88
Nonhuman primate28, 545
Pig1351147014, 20, 91
Rabbit1288032Fetal liver93
Sheep849542, 55
Open in a separate windowOpen in a separate windowFigure 1.The dual roles of MSC: differentiation and modulation of inflammation.Long-term studies in veterinary species have shown no adverse effects with the administration of MSC in a large number of animals.9,10,53 Smaller, controlled studies on veterinary species have shown few adverse effects, such as minor localized inflammation after MSC administration in vivo.7,15,17,45,86,92,98 Private companies, educational institutions, and private veterinary clinics (including Tufts University, Cummins School of Veterinary Medicine, University of California Davis School of Veterinary Medicine, VetStem, Celavet, Alamo Pintado Equine Medical Center, and Rood and Riddle Equine Hospital) offer MSC as a clinical treatment for veterinary species. Clinical uses include tendon and cartilage injuries, tendonitis, and osteoarthritis and, to a lesser extent, bone regeneration, spinal cord injuries, and liver disease in both large and small animals.38,41,113 Even with this broad clinical use, there have been no reports of severe adverse effects secondary to MSC administration in veterinary patients.  相似文献   

2.
Myofilaments and their associated proteins, which together constitute the sarcomeres, provide the molecular-level basis for contractile function in all muscle types. In intact muscle, sarcomere-level contraction is strongly coupled to other cellular subsystems, in particular the sarcolemmal membrane. Skinned muscle preparations (where the sarcolemma has been removed or permeabilized) are an experimental system designed to probe contractile mechanisms independently of the sarcolemma. Over the last few decades, experiments performed using permeabilized preparations have been invaluable for clarifying the understanding of contractile mechanisms in both skeletal and cardiac muscle. Today, the technique is increasingly harnessed for preclinical and/or pharmacological studies that seek to understand how interventions will impact intact muscle contraction. In this context, intrinsic functional and structural differences between skinned and intact muscle pose a major interpretational challenge. This review first surveys measurements that highlight these differences in terms of the sarcomere structure, passive and active tension generation, and calcium dependence. We then highlight the main practical challenges and caveats faced by experimentalists seeking to emulate the physiological conditions of intact muscle. Gaining an awareness of these complexities is essential for putting experiments in due perspective.

IntroductionIn striated muscle, force is generated by sarcomeres located within myocytes (Bers, 2001, 2002). The sarcomere is located within the selectively permeable cell membrane, which supports intracellular ionic homeostasis. Within this highly regulated space, sarcomere force generation is activated by dynamic changes in cytosolic Ca2+. The sarcomeric protein troponin C (TnC) binds to Ca2+, which prompts the formation of myosin cross-bridges between the sarcomere thick (myosin) and thin (actin) filaments. These myofilaments are arranged in a regular lattice oriented along the muscle fiber direction and form the main structural basis of myocyte contraction. The contraction process is regulated by many other intracellular molecules and ions, in particular Mg2+ and H+, as well as by cellular and sarcomeric morphologies.To identify the ionic and molecular mechanisms that regulate the sarcomere, it is necessary to control the chemical environment it is exposed to. The biochemistry of the sarcomere proteins can be studied using in vitro biochemistry assays. However, these fail to account for the regular structure of the sarcomere, which is important for both biochemistry and function. Alternatively, the sarcomeres can be accessed by skinning the muscle, i.e., removing the sarcolemma membrane (or making it permeable to compounds and ions), while preserving sarcomere functionality (Curtin et al., 2015). Exposing the sarcomeres to tailored ionic conditions provides a means to observe and control molecular behavior in a setting that more closely resembles native structures. After skinning, the sarcomere system is effectively isolated from the other cellular subsystems (except in some skeletal muscle experiments that remove the sarcolemma while preserving intracellular organelles and structures; Donaldson, 1985; Fill and Best, 1988; Posterino et al., 2000). This facilitates the study of contraction and its regulation separately from the sarcolemma. The central assumption of skinned muscle experiments is that the response of the sarcomeres to changes in the natural cytosol can be reproduced artificially and controllably through analogous changes in the bathing solution.In skinning protocols (typically used with skeletal muscle) where the SR is preserved, applying caffeine liberates the intracellular Ca2+ reserves to stimulate contraction (Donaldson, 1985). In cases where the T tubules are preserved in the skinning process, ionic substitution in the bathing solution may induce T-tubule membrane depolarization and hence Ca2+ release from the SR (Fill and Best, 1988). An alternative approach to releasing SR calcium is by electric-field stimulation, with the electric field applied transversely relative to the fiber direction (Posterino et al., 2000).The principal readouts of skinned-muscle experiments are contraction kinetics, adenosine triphosphatase (ATPase) activity, and generated force. Their value therefore rests on the premise that the structural integrity of the sarcomeres is preserved. Under this condition, skinned muscle may be viewed as an intermediary experimental system, straddling intact muscle and in vitro molecular experiments.Skinned preparations allow the probing of muscle behavior beyond the current reach of experiments on intact systems. In experiments where contraction is elicited by controlling the bath [Ca2+], the influence of “cytosolic” conditions on Ca2+ sensitivity, in the steady-state, is typically presented in terms of Hill-type force-[Ca2+] relationships, or “F-pCa,” where pCa ≡ − log10[Ca2+]/(mol/liter). Other intracellular molecular structures that fulfill structural and mechanical roles (e.g., titin [Cazorla et al., 2001; Fukuda and Granzier, 2005; Fukuda et al., 2005; Li et al., 2016; Tonino et al., 2017] or the cytoskeleton [Roos and Brady, 1989]) can also be investigated. The controlled progression of the system from one equilibrium state to another has helped to reveal, for example, hysteresis in F-pCa, which may potentially fulfill a physiological role but would be difficult to identify in the dynamic natural system (Bers, 2001; Harrison et al., 1988). Dynamic mechanical experiments also yield insight into myofilament kinetics (Breithaupt et al., 2019; Palmer et al., 2020; Stelzer et al., 2006; Terui et al., 2010). In some (mechanical) skinning methods that preserve the T tubules, further details of the excitation–contraction coupling become experimentally accessible (Fill and Best, 1988; Posterino et al., 2000). The ability to perform protein-exchange manipulations (e.g., cardiac versus skeletal TnC; Babu et al., 1988; Gulati and Babu, 1989), to include fluorescent proteins (e.g., troponin; Brenner et al., 1999), and to perform time-resolved dynamics measurements through the flash photolysis of caged compounds (ATP [Goldman et al., 1982, 1984], inorganic phosphate [Araujo and Walker, 1996; Dantzig et al., 1992; Millar and Homsher, 1990; Tesi et al., 2000], and Ca2+ chelators [Luo et al., 2002; Wahr et al., 1998]) provide additional handles for probing molecular mechanisms. Overall, much of our understanding of striated muscle generally and cytosolic conditions (temperature, pH, etc.) is derived from skinned-muscle experiments (Bers, 2001).Historically, skinning has been performed in a wide array of animal species and striated muscle systems, ranging from single cells to multicellular fibers of cardiac, skeletal, and smooth muscle. Various skinning techniques have been proposed. In “mechanical” skinning, the sarcolemma is effectively peeled off (entirely or partially; Cassens et al., 1986; Endo, 1977; Trube, 1978) by microdissection (Azimi et al., 2020; Donaldson, 1985; Fabiato, 1985b; Fabiato and Fabiato, 1975, 1977, 1978a, 1978b; Fill and Best, 1988; Godt, 1974; Godt and Maughan, 1977; Jewell, 1977; Lamb and Stephenson, 2018; Matsubara and Elliott, 1972; Moisescu, 1976; Rebbeck et al., 2020), while preserving the structural integrity and function of the T tubules and the SR (Lamb and Stephenson, 1990; Posterino et al., 2000; Stephenson, 1981). However, the technique is difficult and no longer used routinely. In contrast, “chemical” skinning involves dissolving or permeabilizing the membrane by applying a chemical agent. The most common agent is Triton X-100 (Solaro et al., 1971), but alternatives include Brij (Hibberd and Jewell, 1982), lubrol (Scheld et al., 1989), glycerol, and saponin (Edes et al., 1995; Endo and Iino, 1980; Gwathmey and Hajjar, 1990; Launikonis and Stephenson, 1997; Patel et al., 2001). Chemical skinning is particularly appropriate for multicellular tissue preparations. Controlling the precise protocol and chemical agent reportedly allows the selective dissolution of the sarcolemma membrane while leaving intracellular organelles (mitochondria and SR) intact. Nonetheless, treatment with (typically 1%) Triton X-100 frees the myofibrils of contamination by mitochondrial, sarcolemmal, and SR membranes while preserving ATPase activity and sensitivity to Ca2+ (Solaro et al., 1971). This straightforwardness makes Triton X-100 demembranation the predominantly used technique today. Other reported skinning approaches use propionate (Reuben et al., 1971) or the Ca2+ chelators EGTA or EDTA (Thomas, 1960; Winegard, 1971; Miller, 1979), but the uncertainty in the underlying mechanisms has undermined the reliability of these methods (Miller, 1979). For completeness, we also mention a less used “freeze drying” approach that arguably preserves the protein content of the fibers better than chemical skinning (De Beer et al., 1992; Schiereck et al., 1993; Stienen et al., 1983).Although, for many years, skinned muscle experiments have served as an invaluable method for investigating fundamental physiology, they are increasingly inspiring more ambitious practical applications. At a practical level, live human cells are inevitably a highly scarce resource, with facilities for collecting, storing, and measuring samples often being displaced both geographically and temporally. These issues are more realistically resolved with skinned cells, which can be preserved frozen for several months (Mosqueira et al., 2019). The development of new sarcomere drugs, including omecamtiv mecarbil and mavacamten, demonstrate that the sarcomere is a viable drug target (Tsukamoto, 2019). Similarly, Ca2+-sensitizing drugs (which act by increasing either the sensitivity to [Ca2+] or the magnitude of the generated force) such as levosimendan (Edes et al., 1995), pimobendan (Fitton and Brogden, 1994; Scheld et al., 1989), sulmazole (Solaro and Rüegg, 1982), isomazole (Lues et al., 1988), and EMD-57033 (Gross et al., 1993; Lee and Allen, 1997) have all been assessed using measurements on skinned fibers. Identifying further novel sarcomere modulator compounds requires large high-throughput screening, which is unrealistic using intact muscle.There is also a growing appetite for exploiting the quantitative value of skinned muscle experiments for more direct clinical applications, such as guiding patient-specific therapies. Much of this ambition relies on the integrative power of computational models to simulate human heart mechanics based on individual patients’ data, linking sub-cellular mechanisms with systemic behavior (Niederer et al., 2019a, 2019b). Building upon basic understanding of muscle behavior, recent developments in biomedical engineering extrapolate physiological processes at the cellular and tissue levels to predict global whole-heart function. As this field continues to grow in maturity, and as model predictions allow more meaningful comparisons with clinical data, efforts are increasingly focusing on quantitatively elucidating the interdependence between cellular behavior, tissue properties, and the anatomy. The quantitative accuracy of the subsystems at all these levels therefore becomes paramount.In both of these evolving applications, the relevance and value of skinned-muscle experiments hinges on their ability to reliably emulate the intact system (Land et al., 2017; Margara et al., 2021; Mijailovich et al., 2021). Skinned-muscle experiments conducted over the past decades confirm the fidelity, in many respects, of these preparations as valid experimental models. However, they also highlight caveats and significant interpretational challenges. Gaining an awareness of these issues is becoming all the more essential to avoid misinterpretations that may have practical consequences. This review therefore aims to highlight these challenges, to help users of skinned-based measurements put them in an appropriate perspective.The present review is structured as follows. We first compare measurements of the principal physiological properties of skinned and intact muscle, highlighting similarities and discrepancies. We focus primarily on chemical skinning, and in particular Triton X-100 (the predominantly used chemical agent). We then describe practical challenges involved in conducting experiments, insofar as they impact on measurement outcomes. We conclude with a summary of recommendations and main caveats.Comparing skinned and intact muscleSkinned muscle experiments aim to reveal and controllably reproduce features of the physiological function of sarcomeres. However, notable discrepancies arise between skinned- and intact-muscle measurements of basic muscle properties that govern overall muscle function. To establish these differences rigorously at the single-cell level encounters significant methodological challenges. Although it might seem obvious that this would require doing measurements systematically on both preparation types in tandem, many early experiments were done predominantly on skinned rather than on intact cells (King et al., 2011). This stems largely from the specific challenges of noninjurious cell attachment and performing small-force measurement on intact single cells (Brady, 1991). More recently, technical developments (e.g., involving the use of flexible carbon fibers to hold the cells at opposite ends; Iribe et al., 2007; Le Guennec et al., 1990; Yasuda et al., 2001) have made these measurements more practicable. Despite these advances, however, only a fraction of studies in the literature have systematically made direct comparisons between skinned and intact systems taken from the same species under optimally similar conditions (see the selection listed in
ReferenceSystemIntactSkinning method[Mg2+] (mM)Ionic strength (mM)pH
Reuben et al. (1971) CrayfishEGTA-3007.0
Winegard (1971) Frog cardiacEDTA1-6.5–7.0
Matsubara and Elliott (1972) Frog skeletalXDissection1-7.0
Godt (1974) Frog skeletalDissection51507.3
Wood et al. (1975) Human skeletalEGTA2–4-7.0
Moisescu (1976) Frog skeletalDissection11507.1
Godt and Maughan (1977) Frog skeletalXDissection31507.0
Best et al. (1977) Rat cardiacHomogenization0.05, 11507.0
Trube (1978) Mouse cardiacDissection (partial)41327.0
Gordon (1978) Rabbit smoothTriton X-1001.0–6.91307.0
Stienen et al. (1983) Frog skeletalFreeze drying1.11607.0
Fabiato and Fabiato (1975, 1978a, 1978b)Rat cardiacDissection0.321607.0
Fabiato and Fabiato (1978a) Frog skeletalDissection0.321607.0
Fabiato (1981) Rat cardiacXEGTA11607.1
Fabiato (1981) Rabbit cardiacXEGTA11607.1
Fabiato (1985b) Canine cardiacDissection31707.1
Hibberd and Jewell (1982) Rat cardiacBrij-580.32007.0
Solaro et al. (1971, 1976); Solaro and Rüegg (1982)Canine cardiacTriton X-100Var1007.0
Donaldson (1985) Rabbit skeletalDissection11507.0
Kentish et al. (1986) Rat cardiacXTriton X-10032007.0
Fill and Best (1988) Frog skeletalDissection11507.0
Lues et al. (1988) Various cardiacTriton X-100-1406.7
Roos and Brady (1989) Rat cardiacXTriton X-100-1607.1
Scheld et al. (1989) Human cardiacLubrol PX-1406.7
Harrison and Bers (1989) Rabbit cardiacTriton X-1002.2-7.0
Lamb and Stephenson (1990) Toad skeletalDissection1-7.10
Gwathmey and Hajjar (1990) Human cardiacXSaponin31607.1
Sweitzer and Moss (1990) Rat cardia, rabbit skeletalTriton X-10011807.0
Millar and Homsher (1990) Rabbit skeletalEGTA12007.1
De Beer et al. (1992) Rabbit skeletalFreeze drying---
Gross et al. (1993) Guinea pig cardiacTriton X-100--7.4
Gao et al. (1994) Rat cardiacXTriton X-1001.2-7.0
Wolff et al. (1995a) Canine cardiacTriton X-10011807.0
Edes et al. (1995) Guinea pig cardiacSaponin-1607.4
Araujo and Walker (1996) Rat cardiacTriton X-1001180-
Allen et al. (2000) Rat cardiacTriton X-1001–81507.0
Posterino et al. (2000) Rat skeletalDissection1-7.1
Irving et al. (2000) Rat trabeculaeXTriton X-100-2007.35
Patel et al. (2001) Mouse cardiacSaponin + Triton X-100-1807.0
Konhilas et al. (2002) Rat trabeculaeTriton X-1001180-
Luo et al. (2002) Rabbit skeletalTriton X-10011807.0
Fukuda et al. (2003) Bovine cardiacTriton X-10011807.0
Prado et al. (2005) Rabbit skeletalXTriton X-100-1807.0
Fukuda et al. (2005) Bovine and rat cardiacTriton X-10011807.0
Stelzer et al. (2006) Mouse cardiacSaponin + Triton X-10011807.0
Terui et al. (2010) Pig cardiacTriton X-10011807.0
Gillis and Klaiman (2011) Fish cardiacTriton X-10011707.0
Curtin et al. (2015) Rabbit skeletalXTriton X-10022007.1
Li et al. (2016) Rabbit skeletalTriton X-100-1807.0
Land et al. (2017) Human cardiacTriton X-10012007.1
Stehle (2017) Guinea pig cardiacTriton X-100-1707.0
Breithaupt et al. (2019) Rat cardiacGlycerol + Triton X-10012007.0
Giles et al. (2019) Mouse cardiacSaponin + Triton X-10011807.0
Azimi et al. (2020) Rat skeletalDissection1-7.1
Rebbeck et al. (2020) Human and rat skeletalDissection1-7.4
Palmer et al. (2020) Mouse cardiacTriton X-10012007.0
Open in a separate windowA mark (X) in the Intact column indicates studies that directly compared measurements on both intact and skinned muscle (either performed within the same study or by considering previously published results). Var, variable.Sarcomere structureThe geometrical configuration and separation of the myofilaments regulate their interaction in the native system and hence their ability to generate tension. Under normal physiological conditions, the filament lattice structure is influenced by a complex balance of opposing forces, which include (Millman, 1998) electrostatic interactions between both thick and thin filaments (with charge being affected by pH and screened by the surrounding ionic strength), van der Waals forces, and entropic thermal forces, as well as Donnan osmotic force (whereby water enters the filament lattice to dilute counterions surrounding the charged filaments; Ilani, 2015). It is therefore unsurprising that this balance becomes disrupted upon removal of the sarcolemma.Muscle skinning broadly conserves the sarcomere assembly, but, as illustrated below, detailed quantitative features are altered at different scales. Microscopy and synchrotron x-ray measurements on skinned muscle report a modest increase in sarcomere length (∼3%), accompanied by a greater lateral expansion (up to twofold, depending on conditions), compared with intact cells. This is apparent in both skeletal (Matsubara and Elliott, 1972) and cardiac muscle (Irving et al., 2000; Roos and Brady, 1989). In both skinned and intact preparations, longitudinal stretching decreases the myofilament lattice spacing monotonically. This occurs more slowly in the skinned system, especially at large sarcomere lengths (Fig. 1; Irving et al., 2000). Despite their similar overall behavior, different physical effects are likely to operate in the two systems. The volume of intact cells is approximately conserved (Yagi et al., 2004), and therefore, stretching the cell decreases its cross-sectional area. As the sarcomere number remains constant, this increases the sarcomere density and hence stress generation (force per unit cross-sectional area). The constant-volume constraint is removed in skinned systems (Godt and Maughan, 1977; Irving et al., 2000; Matsubara and Elliott, 1972), which allows the structure to respond more visibly to other forces.Open in a separate windowFigure 1.Average myofilament spacing as a function of the sarcomere length in intact and relaxed skinned rat trabeculae, measured by x-ray diffraction. Adapted from Irving et al. (2000).The expansion of the myofilament spacing in skinned preparations can be reversed by increasing the osmotic pressure of the solution using dextran (Cazorla et al., 2001; Konhilas et al., 2002). However, this compressive effect does not by itself return the myofilaments fully to their intact physiological state (Konhilas et al., 2002). Recent x-ray diffraction experiments have identified an alteration of the detailed molecular structure of the thick filaments below physiological temperatures (Caremani et al., 2019, 2021). Although this effect is overlooked in many experiments, it may significantly affect cross-bridge kinetics.Skinning may also impact sarcomere morphology on larger scales. While measuring the effect of skinning on the sarcomere length in rat heart trabeculae using laser diffraction, Kentish et al. (1986) observed an increase in the diffraction intensity and a decrease in the dispersion of the first-order diffraction. Although this effect might result from the loss of intracellular scatterers (mitochondria, cytosolic proteins, etc.) upon skinning, the authors hypothesize that the skinning process might effectively enhance the homogenization of the sarcomere environment of the skinned tissue, relative to the intact one, where individual cells may display spontaneous and uncoordinated contractions. Nonetheless, the relative homogeneity of the skinned tissue degrades rapidly after successive contractions, possibly due to a loss of integrity of the cellular structure and content, in both cardiac (Kentish et al., 1986) and skeletal muscle (Fabiato and Fabiato, 1978b). This reflects a degree of irreproducibility inherent to skinned systems.Sarcomere structure strongly regulates contractile properties. Changes in both sarcomere length and interfilament spacing affect cross-bridge cycling and influence the regulation and amount of tension generated by skinned sarcomeres. Recent evidence also suggests that skinning may perturb myofilament interactions via steric effects due to myosin head orientations (Caremani et al., 2019, 2021; Konhilas et al., 2002). These effects, discussed further below, highlight the complexity in the disruption of the sarcomere function caused by skinning, relative to intact muscle, and the challenge in rationalizing their discrepancies based on fundamental physics principles. Ultimately, the extent to which skinning modifies sarcomere functionality bears critically on the interpretation of skinned muscle experiments.Passive mechanical compliancePassive mechanical properties of cardiac muscle strongly govern diastolic behavior. In intact tissue, these may have contributions originating in the cells themselves and the extracellular matrix (mostly comprising collagen). Passive tension and sarcomere length vary nonlinearly in both intact and skinned rat ventricular trabeculae preparations (Fig. 2; Kentish et al., 1986). However, in the skinned case, this length dependence is weaker, and the extension range is greater, indicating the presence of additional parallel elastic elements in the intact tissue, potentially associated with the sarcolemma or extracellular structures.Open in a separate windowFigure 2.Passive stress increasing with sarcomere length in skinned and intact rat ventricular trabeculae. The skinned results indicate enhanced mechanical compliance. Adapted from Kentish et al. (1986). Fig. 2 is reprinted with permission from Circulation Research.The qualitative similarity in the passive force-length relations in intact and skinned muscle makes the attribution of their quantitative differences challenging. The direct contribution of the sarcolemma itself, although plausible in principle, is expected to be weak, given its high compliance. However, it is more likely to contribute indirectly, given that the cell volume remains approximately constant upon stretching (Yagi et al., 2004). This effect may also be exacerbated by the Coulombic repulsion of the negatively charged myofilaments that, when confined within a fixed volume, would enhance resistance to lateral cellular compression (Kentish et al., 1986). Skinning may also cause the loss of intracellular components that contribute to the passive mechanics, e.g., a nonfilamentous stroma, comprising vesicular elements that dissolve in the skinning process (Kentish et al., 1986). Similarly, the loss of tubulin dimers from the cytoplasm may interfere with the viscoelastic behavior and resistance to cell shortening of the microtubule cytoskeleton (White, 2011).Structural differences can also explain discrepancies between skinned and intact muscle properties. Variations in the ionic strength acting on skinned myocytes have identified a mechanical contribution from the intracellular cytoskeleton (Roos and Brady, 1989). Similarly, titin contributes to the passive stiffness in isolated myofibrils and skinned single fibers, separately from the extracellular (mostly collagen) contribution (Cazorla et al., 2001; Fukuda and Granzier, 2005; Fukuda et al., 2005; Herzog, 2018; Powers et al., 2017). Within the isolated sarcomeric system, the stiffness varies inversely with the titin molecular size (Mijailovich et al., 2019; Prado et al., 2005), but this correlation disappears in intact fiber bundles, where extracellular contributions (e.g., from collagen) may dominate (Brower et al., 2006; Chung and Granzier, 2011; Fomovsky et al., 2010).Although the above observations highlight the limitations of using skinned preparations as a model for investigating passive mechanics in intact tissue, there may be indirect implications for contractile function. The distribution of force between passive and active mechanisms affects contraction, e.g., via force-dependent Ca2+ sensitivity (Cazorla et al., 2001; Fukuda and Granzier, 2005; Fukuda et al., 2005; Martyn and Gordon, 2001; Mijailovich et al., 2019; Sweitzer and Moss, 1990). In particular, passively elastic titin influences active contraction via the release of troponin I (TnI) from actin, as a result of the redistribution of mechanical load and strain on both the thick and thin filaments (Mijailovich et al., 2019). It may also determine the sarcomere length for a given afterload or the shortest sarcomere length in isotonic contractions.Calcium dependence of tension generationSkinned preparations are often used to measure the Ca2+ dependence of force development under equilibrium conditions. Measured F-pCa relations (e.g., Fig. 3) are conventionally characterized by their maximum saturating value, the location of the half-maximum point (the “sensitivity,” pCa50), and the Hill coefficient n (quantifying the rate of rise and taken as a measure of cooperativity). To assess their validity, analogous F-pCa relations may also be generated in intact muscle by controlling the intracellular [Ca2+] homeostasis via tetanization, i.e., high-frequency activation (Fig. 3). Reported F-pCa relationships vary significantly according to the muscle type and preparations (Fabiato, 1981; Fukuda et al., 2003; Hibberd and Jewell, 1982; Kentish et al., 1986). This is problematic insofar as measurements in skinned systems aim to reproduce the “authentic” behavior in the intact system. The most intuitive mechanism involves an increased Ca2+-troponin binding affinity (Allen and Kentish, 1985; Kentish et al., 1986; Stephenson and Wendt, 1984), but more complex contributions also originate in the thick-filament structure upon stretching (Zhang et al., 2017).Open in a separate windowFigure 3.Comparing the force-calcium relationship in intact and skinned muscle. (a) Intact (ferret, 30°C; Yue et al., 1986) versus skinned (rabbit, 29°C; Harrison and Bers, 1989) muscle. (b) Pooled measurements derived from intact (solid symbols, pCa50 ≈ 6.21, n ≈ 4.9) and skinned (open symbols, 6.04, 3.8) preparations of the same rat ventricular myocytes. max, maximum. From Gao et al. (1994). Fig. 3 is reprinted with permission from Circulation Research.Both pCa50 and n are significantly enhanced in the intact case (in ferret) relative to skinned tissue (rabbit), substantially exceeding typical species-dependent variability observed in skinned muscle (Fig. 3 a; Bers, 2001). A similar qualitative conclusion was drawn from comparisons of intact and skinned preparations of the same rat ventricular myocytes (Fig. 3 b; Gao et al., 1994). These discrepancies are particularly significant when comparing the measured sensitivity values (pCa50 = 5.52; Land et al., 2017) with physiological systolic [Ca2+] levels in the heart (0.6 µM ≃ pCa 6.22; Coppini et al., 2013; Land et al., 2017). Thus, the skinned muscle measurements are clearly incompatible with observed physiological behavior in intact myocytes and hence at the organ scale. Although the dominant underlying biophysical reason for these differences is uncertain, the detailed experimental conditions are fundamentally important (Bers, 2001). A rigorous quantitative comparison is therefore challenging.Skinning may affect the F-pCa relation via the sarcomere structure. An increase in the myofilament spacing plausibly reduces the rate of myosin cross-bridge formation and hence the amount of force generated for a given [Ca2+]. This would translate into a reduction in pCa50, induced by muscle shortening, as observed in both skinned and (more weakly) intact preparations (Komukai and Kurihara, 1997). This mechanism may arguably contribute to the Frank–Starling mechanism in muscle, whereby the strength of contraction increases with stretch. However, this intuitive explanation has been shown to be insufficient in accounting for the complete effect on calcium sensitivity (Irving and Craig, 2019; de Tombe et al., 2010). It is also contradicted by experiments in which comparable myofilament spacings were achieved either via dextran-based osmotic compression or by sarcomere stretching (Konhilas et al., 2002). These discrepancies suggest that the filament spacing may not be the dominant contributor to pCa50. However, this conclusion assumes the functional equivalence of the two scenarios. This may not be the case, as skinning may perturb other intracellular structures (e.g., titin or thin-filament regulatory proteins; Komukai and Kurihara, 1997). Experiments on mouse skinned cardiomyocytes have suggested that titin regulates filament spacing (Cazorla et al., 2001). Osmotic pressure may also impact the cross-bridge structural configuration on smaller molecular scales (Caremani et al., 2021; Konhilas et al., 2002).The sensitivity of the myofilaments to their chemical environment adds a further layer of complexity to skinned experiments. As discussed further below, F-pCa curves depend on the ionic strength, [Mg2+], and pH, all of which are routinely specified in skinned-experiment protocols. Skeletal muscle measurements have shown that increasing the temperature of the bathing solution increases the [Ca2+] required to activate skinned muscle as well as the maximal generated force (Godt and Lindley, 1982). Similarly, decreasing [Mg2+] lowers the activation [Ca2+] (Godt and Lindley, 1982). However, the native cell features other regulators that are lost during skinning and are not typically included in experiments. Sensitizers like taurine, carnosine-like compounds, and myosin light-chain kinase modestly increase the Ca2+ sensitivity (Gao et al., 1994). β-Adrenergic stimulation of intact muscle activates PKA, which in turn affects sarcomere dynamics by phosphorylating TnI and myosin-binding protein C (Gillis and Klaiman, 2011; Kentish et al., 2001; Patel et al., 2001). TnI phosphorylation decreases its binding affinity for Ca2+ (de Tombe and Stienen, 1995; Patel et al., 2001; Zhang et al., 1995), while that of myosin-binding protein C induces a movement of the myosin heads that accelerates force development.Despite their appealing relative simplicity, inconsistencies between skinned and intact muscle suggest fundamental alterations to muscle function by the skinning process. Following the rapid length release and restretch of skinned rat trabeculae, force redevelopment is Ca2+-dependent (Wolff et al., 1995b), unlike the rate of force redevelopment after a rapid-length release of intact ferret trabeculae (Hancock et al., 1993). This discrepancy is arguably explained by the relative dominance of thin- or thick-filament kinetics, respectively (Hunter et al., 1998).Taken together, these results illustrate the challenge of objectively determining the physiological Ca2+ dependence of muscle tension, in large part owing to the considerable technical challenge of replicating the native conditions of the myofilament system in vitro.Force-length relationThe sarcomere length dependence of force generation that underlies the Frank–Starling mechanism is a fundamental property of muscle behavior. Contributing mechanisms include the variation in myofilament overlap as the sarcomere is stretched, the apparent increase in the binding of Ca2+ to TnC with increasing length (Hibberd and Jewell, 1982; Kobirumaki-Shimozawa et al., 2014), and the modulation of the thick- (Fukuda et al., 2001; Zhang et al., 2017) and thin-filament structures (Zhang et al., 2017). The passive mechanical properties of titin (which vary according to the isoform) affect the variation in the lattice spacing under tension, and hence the length dependence of the actomyosin interaction (Fukuda et al., 2003). Recent evidence shows that the strain on titin, effectively acting as a force sensor, contributes to the Frank–Starling effect by influencing the structure of both the thin and thick filaments that are different from Ca2+-induced changes (Ait-Mou et al., 2016).Length-dependent tension, manifested in the F-pCa relationship, is qualitatively similar in intact and skinned preparations (Fig. 4). In the intact case, active tension was measured as the difference between the maximum tension in transiently stimulated muscle and the resting (unstimulated) tension at the same sarcomere lengths. The process was repeated at different [Ca2+] values in the bathing solution, so as to modulate the intracellular calcium. Comparing Fig. 4, a and b, for sufficiently low [Ca2+] below the level for full activation, the skinned- and unskinned-tissue measurements show a qualitatively similar transition from a concave to a convex dependence as [Ca2+] is increased. The results suggest that, whereas the unskinned system sustains no active tension for sarcomere lengths below ∼1.6 µm, the skinned preparation allows tension generation in this regimen, albeit at unphysiologically large [Ca2+]. However, the ability to measure (potentially heterogeneous) sarcomere lengths accurately in this regimen is questionable.Open in a separate windowFigure 4.Active force generation in intact and skinned rat ventricular trabeculae as a function of sarcomere length, for different bath [Ca2+]. From Kentish et al. (1986). Fig. 4 reprinted with permission from Circulation Research.For sufficiently low [Ca2+], the basic contraction mechanisms are thus preserved after skinning, at least qualitatively, suggesting that the general features of the force-length relationship are inherent myofibril properties. However, this conclusion assumes that (1) the chemical environments of the myofilaments are largely similar (any experimentally defined environment can only approximate the real cytosol), and (2) myofilament properties are not appreciably modified by the skinning process. The latter condition may be affected by the reported swelling of the myofilament lattice (Godt and Maughan, 1977; Irving et al., 2000; Konhilas et al., 2002; Matsubara and Elliott, 1972) or by any damage to the filaments occurring during the skinning process. Both of these effects should reduce the gradient of the tension relative to stretch.Significant variations in measurements may originate from structural causes at different levels. The above results, derived from trabeculae, show a steeper length dependence for short sarcomere lengths, compared with those of Fabiato and Fabiato (1975) on (mechanically) skinned maximally activated single ventricular myocytes (Kentish et al., 1986). This discrepancy might be ascribed either to the conservation of intercellular connections and extracellular connective tissue that might be lost in the skinned single myocytes, or to differences in the myofilament spacing in the multicellular tissue preparation. Some more subtle effects, such as the temperature-dependent alteration of the internal thick-filament structure in demembrenated muscle, observed recently (Caremani et al., 2019, 2021), seldom receive due consideration.Length-dependent F-pCa measurements show the sensitivity of muscle activation by calcium increasing with length, as marked by an increase in pCa50 (Fig. 5). The maximum generated force at saturating [Ca2+] also increases. However, the Hill coefficient (n ≈ 7) does not vary significantly. A small but statistically significant increase in n was previously reported (Kentish et al., 1986), albeit based on sparser data, and was explained by invoking several mechanisms, e.g., interactions between adjacent tropomyosin molecules or alterations to the number of possible cross-bridges. Nonetheless, significant discrepancies even in the absolute values of n reported in other studies are also highlighted, potentially related to experimental conditions and the choice of skinning protocol.Open in a separate windowFigure 5.Dependence of the calcium sensitivity on sarcomere length. (a) Hill-type F-pCa for sarcomere lengths (SLs) = 1.85, 1.95, 2.05, 2.15, and 2.25 µm. Forces are normalized to the maximum force measured at SL = 2.05 µm. The data do not show a change in the Hill coefficient. (b) Increase in the Ca2+ sensitivity (decreasing [Ca2+] at half-maximum) with increasing SL, measured from the position of the inflection point in the fitted Hill curves from panel a. Adapted from Dobesh et al. (2002).The force-length relation in striated muscle underpins its central physiological role. Whereas the appeal of skinned muscle experiments for characterizing force generation is highlighted by numerous experiments, rationalizing quantitative differences remains notoriously challenging. In large part, this stems from the highly multifarious influence of the skinning process on the intracellular system and on details of the preparation protocol.Practical challenges: performing skinned muscle experimentsThe previous section illustrated the ability of skinned muscle preparations to reproduce intact muscle behavior while highlighting significant quantitative differences between the two systems. Clarifying the sources of these differences is crucial when developing practical applications that seek to exploit skinned muscle as a reductionist model for native-state muscle. One important hurdle is to correctly replicate the chemical and physiological intracellular environment, in particular with regard to [Mg2+], [ATP], pH, and the ionic strength. By tuning the experimental parameters to match the physiological conditions, the consistency between skinned and intact systems can be significantly improved (Gao et al., 1994; Mijailovich et al., 2021). Over decades, systematic efforts have sought to achieve this through detailed computations of the chemical equilibria of the bathing solutions (Fabiato, 1985a; Fabiato and Fabiato, 1975, 1977; Godt and Maughan, 1977; Moisescu, 1976). In practice, experimental protocols vary, sometimes idiosyncratically, between laboratories.This section outlines some of the elements of experimental protocols for skinned muscle that pose particular challenges insofar as they may significantly impact measurement outcomes.Bathing solution composition

ATP

After skinning, mitochondrial function is compromised, and hence, myocytes can no longer produce ATP (Rüegg, 2012). In multicellular tissue experiments, even a plentiful supply of ATP in the bathing solution may diffuse too slowly to maintain a homogeneous concentration throughout the fiber network (Godt, 1974). However, the inherent ATPase activity of muscle contraction implies a consumption of ATP supplies over the time of experiments. ATP-regenerating systems include creatine phosphate (typically 10–15 mM; Godt, 1974; Lamb and Stephenson, 2018). Nonetheless, in multicellular tissue, the rapid hydrolysis of ATP within the contractile system may yet produce an ATP concentration gradient between the interior and exterior of the network that inaccurately reflects the native state. This problem is arguably less serious in cardiac than skeletal myocytes (typical cardiac cell diameters are ∼13−20 µm, and lengths are ∼60−120 µm [Campbell et al., 1987, 1989; Liu et al., 1991], whereas skeletal muscle fiber diameters range from several microns to thousands of microns [Jimenez et al., 2013], with lengths sometimes reaching centimeters). However, the problem may yet arise in trabeculae.The physiological role of ATP in a given experiment, in addition to its participation in cross-bridge cycling, depends on the muscle preparation. In skeletal muscle experiments that preserve intracellular membrane structures (Endo and Iino, 1980; Launikonis and Stephenson, 1997), ATP governs calcium pumping into the SR (Godt, 1974; Lamb and Stephenson, 2018). This function is of course nonexistent in preparations where the SR has been dissolved. Alongside its role as energetic fuel, ATP also maintains the extensibility of the muscle by allowing myosin to dissociate from actin (Best et al., 1977; Weber and Murray, 1973).The decrease in maximum force with increasing [ATP] (in its physiological form MgATP; Fig. 6 b) is intuitively explained by the reduction in the number of formed cross-bridges (since ATP binding is associated with the release of rigor myosin; Best et al., 1977). An accompanying decrease in pCa50 and an increase in the Hill coefficient (Fig. 6 a; Best et al., 1977) are both complicated by their Mg2+ dependence. These observations have been explained in terms of the effective cooperativity between neighboring cross-bridges in altering the inhibitory properties of troponin, which would arguably increase cross-bridge activation at a given [Ca2+] (Best, 1983; Best et al., 1977; Weber and Murray, 1973). However, this scenario is difficult to reconcile with analogous studies in skeletal muscle that report a qualitatively similar behavior for pCa50 but with little [MgATP] dependence on maximum tension (Godt, 1974).Open in a separate windowFigure 6.Dependence of the force–calcium relationship on MgATP in the rat heart. (a) Decrease in Ca2+ sensitivity (increase in [Ca2+] at half-maximum) as [MgATP] increases from 30 to 100 µM ([Mg2+] = 50 µM). (b) Decrease in the maximum tension with increasing [MgATP]. Adapted from Best et al. (1977).

Mg2+

Mg2+, the second most abundant cation in muscle cells after K+, regulates the Ca2+ sensitivity of myofilament activity via its binding affinity to troponin (Alpert et al., 1979; Bers, 2001; Best, 1983; Best et al., 1977; Rayani et al., 2018; Tikunova and Davis, 2004). The Ca2+-specific low-affinity binding site (site II) at the N-terminal end of cardiac TnC serves as the principal initiator of contraction in the presence of Ca2+ (Bers, 2001). However, the structure of TnC is also controlled by binding sites III and IV, located at the C-terminal end, which competitively bind either Ca2+ (with high affinity) or Mg2+ (low affinity; Rayani et al., 2018; Tikunova and Davis, 2004). According to some cardiac muscle experiments, more Ca2+ is required to achieve a given degree of activation as [Mg2+] increases in the millimolar range (Best, 1983; Tikunova and Davis, 2004), consistent with competitive binding of these ions on TnC. However, this interpretation is contested by other cardiac experiments claiming negligible impact to the Ca2+ sensitivity under even an order-of-magnitude change in Mg2+ (Allen et al., 2000). The precise effect of Mg2+, while being potentially artifactual in some cases, may also vary with the dominant mechanism of action in the specific muscle system considered.Historically, setting the physiologically correct [Mg2+] has been challenging. Its determination requires the consideration of multiple binding equilibria and is naturally prone to uncertainty (Lamb and Stephenson, 2018). Given its relative abundance, cytosolic Mg2+ was initially assumed to merely ensure the balance for anionic charge, but its regulatory role was recognized subsequently. Various techniques have measured [Mg2+] (using spectrophotometry, Mg2+-sensitive electrodes, dye-based measurements, etc.). However, these measurements carry significant uncertainties, particularly given the difficulty of discerning free cytosolic Mg2+ from the total cellular magnesium (up to 20 times greater, contained in MgATP or cellular compartments) or interference from other ions (Romani and Scarpa, 1992). Many measurements report [Mg2+] as being consistently 0.4–0.8 mM but reaching up to 3.5 mM in some cases (Romani and Scarpa, 1992). In the intact rat heart specifically, values of 0.72 mM (from epifluorescence; Gao et al., 1994) or 0.85 mM (19F-NMR; Murphy et al., 1989) have been measured. [Mg2+] in excess of several millimolars are used in some studies but are known to be above the physiological level (Bers, 2001; Hunter et al., 1998).

pH

Intracellular pH in intact muscle regulates all the stages of tension generation, including the handling of Ca2+ by sarcolemmal electrophysiology, its delivery to the myofilaments, and the response of the filaments to the Ca2+ signal (Orchard and Kentish, 1990). This versatility makes it difficult to establish the relative significance of pH on sarcomere function specifically.In skinned muscle, a decrease in pH decreases pCa50. The results in Fig. 7 show a 0.1% drop in pH producing a 0.1% drop in pCa50 (Bers, 2001; Orchard and Kentish, 1990). The precise mechanism for this effect remains uncertain but may involve competition of H+ with Ca2+ for binding to TnC, interactions within the troponin complex, or the shielding of the net effective negative charge of the TnC binding site (Orchard and Kentish, 1990). Although a decrease in calcium sensitivity was also confirmed qualitatively in tetanized intact cardiac muscle (Marban and Kusuoka, 1987), the results differ quantitatively.Open in a separate windowFigure 7.Dependence of pH on the force-calcium relationship in guinea pig trabeculae. Adapted from Orchard and Kentish (1990).The observed decrease in maximal force resulting from decreasing pH in skinned muscle may be due to a direct impact on the efficiency of the coupling of ATP hydrolysis to cross-bridge force generation (Fig. 7; Orchard and Kentish, 1990). ATPase activity is affected by pH in intact muscle, albeit more weakly (Blanchard and Solaro, 1984; Kentish and Nayler, 1979; Orchard and Kentish, 1990). However, it is uncertain whether the same dominant mechanisms are relevant in the intact and skinned cases.The suitability of skinned muscle experiments for reliably investigating pH dependence is thus questionable. Bathing solutions for skinned muscle are typically designed with a high pH-buffering capacity (e.g., with 90 mM HEPES) to maintain a stable pH ∼7 (see Lamb and Stephenson, 2018).

Ionic strength

Ionic strength impacts inversely on the maximum force generated by skinned muscle (Fig. 8; Kentish, 1984). In practice, it can be controlled experimentally, in both cardiac and skeletal experiments, for example by varying KCl in the bathing soution (Kentish, 1984; Solaro et al., 1976). Reported ionic strength values range between 150 and 200 mM (Fig. 8). The inhibition of tension appears to be associated with Ca2+ binding, as this ionic strength dependence is [Ca2+] dependent only in the presence of MgATP (in skeletal muscle; Solaro et al., 1976). However, the precise ionic strength in intact muscle is uncertain (Gao et al., 1994), as reflected in the lack of consensus in the literature (see Open in a separate windowFigure 8.Dependence of generated tension on osmolarity. The osmolarity Γ/2 was controlled by varying (a) the Cl salt (filled circles: KCl; open circles: NaCl; diamonds: TMACl; triangles: choline Cl) or (b) K+ salt concentrations (filled circles: KCl, filled squares: K propionate; open square: K Mes), for pCa = 3.8. The consistency between the results suggests that the tension depends predominantly on the ionic strength rather than on the size of specific ions. From Kentish (1984). Fig. 8 reprinted with permission from Journal of Physiology.

Conclusion

The above considerations of ATP, Mg2+, pH, and ionic strength highlight the sensitivity of skinned muscle measurements to the precise solution composition. Establishing the correct recipe is made all the more challenging given that the impact on measured force generation varies between muscle systems and species. As argued above, although differences between measurements often appear to be quantitative, this does not exclude the possibility of qualitative differences in the dominant mechanisms of action. This fundamental ambiguity introduces considerable complication in translating results meaningfully to the intact system.TemperaturePhysiological function emerges from the balance of multiple temperature-dependent processes. Although measurements should thus ideally always be done at physiological temperature, lower temperatures are often used in practice due to the impaired stability of the sarcomere structure in skinned preparations at higher temperatures. This can have significant consequences on contraction, given the highly variable temperature sensitivities of different subcellular mechanisms (Rall and Woledge, 1990).There is widespread agreement that cooling reduces the maximum generated force in a wide range of muscle types and preparations (Fig. 9; Fabiato, 1985b; Godt and Lindley, 1982; Harrison and Bers, 1989; Stephenson and Williams, 1985; Sweitzer and Moss, 1990). This result has been argued to result more from a change in the force exerted by cross-bridges than from the number of cross-bridges formed (Sweitzer and Moss, 1990). In contrast, the temperature dependence of calcium sensitivity is less consistent. Skinned muscle displays either an increase (Brandt and Hibberd, 1976; Harrison and Bers, 1989; Orentlicher et al., 1977; Sweitzer and Moss, 1990) or a decrease in pCa50 (Fabiato, 1985b; Godt and Lindley, 1982; Stephenson and Williams, 1985) with increasing temperature. However, the former result may be an artifact associated with heterogeneous shortening of sarcomeres at higher temperatures (Sweitzer and Moss, 1990).Open in a separate windowFigure 9.Temperature dependence of the F-pCa relationship in skinned trabeculae from the rabbit ventricle, showing an increase in both the maximum tension Cmax and the sensitivity pCa50 (pCa at half-maximum) with increasing temperature. Adapted from Harrison and Bers (1989).More recent work has revealed further complications in the regulatory role of temperature in muscle. In particular, temperature influences structural thick-filament regulation in both cardiac and skeletal muscle (Caremani et al., 2019, 2021; Park-Holohan et al., 2021). Reducing the temperature disrupts the orderly configuration of the myosin lever arms along the thick filaments, making them less available for force generation and causing an almost threefold decrease in total tissue force.The above experimental results highlight the multifaceted complexity of temperature dependence that arises from the interdependence of multiple molecular processes. Skinned preparations constitute only a subsystem within the overall muscle system, and there is therefore no guarantee that the kinetic balance within the reduced system is physiologically accurate.Sarcomere heterogeneityFor conceptual convenience, muscle tissue is often represented as a homogeneous assembly of identical sarcomeres acting in synchrony. This picture is simplistic in reality. Aspects of muscle dynamics, even under isometric conditions, derive specifically from the heterogeneous behavior at the sarcomere level. For example, within a myofibril, tension relaxation proceeds with the onset of rapid lengthening (“give”), initially in a single weak sarcomere, that then propagates to other sarcomeres along the myofibril (Edman and Flitney, 1982; Poggesi et al., 2005; Stehle, 2017). This effect accounts for the [Pi]-dependent asymmetry in the force kinetics that is observed in contraction-relaxation cycles when [Ca2+] is stepped up and down (Poggesi et al., 2005). It also suggests that relaxation kinetics is governed not only by the rate-limiting steps of the cross-bridge cycle of a generic myosin molecule but also by collective effects at a higher structural level.This effect arguably escapes notice in skinned-fiber experiments that exploit the flash photolysis of caged compounds to time-resolve the details of cross-bridge–cycle kinetics (e.g., the photorelease of inorganic phosphate Pi modulates cross-bridge kinetics; Araujo and Walker, 1996; Dantzig et al., 1992; Millar and Homsher, 1990; Tesi et al., 2000). These experiments suffer from important practical limitations. In particular, the relatively modest (unidirectional) changes in [Pi] achievable by photorelease fail to disrupt the chemomechanical equilibrium of the sarcomeres sufficiently to generate heterogeneous give. Under these near-equilibrium conditions, observed changes in force are more likely to reflect rate-limiting single-cross-bridge kinetics than transients in sarcomere heterogeneity. This obstacle was bypassed in experiments done on isolated myofibrils, which, in contrast, allow sufficiently large jumps in [Pi] (in both directions) to be imposed by rapid solution change (Poggesi et al., 2005; Stehle, 2017). By monitoring the progression of tension decay in conjunction with the lengths of individual sarcomeres, these experiments highlight the role of sarcomere dynamics in accounting for tension relaxation. Compared with skinned-tissue experiments, they also provide better consistency with the relaxation kinetics (kTR) observed in mechanically induced force redevelopment (Stehle, 2017).Practical considerationsThe preceding discussion has highlighted the value of skinned muscle in emulating the essential features of intact muscle contraction in vivo. On the other hand, we have also described how discrepancies between intact and skinned muscle properties are sufficiently significant as to mar the prospect of considering skinned preparations as unambiguous surrogates. The underlying causes are complex, and it is often difficult to distinguish between experimental artifacts and manifestations of genuine physiological differences. This complexity is further compounded by species- or system-dependent specificities (e.g., cardiac versus skeletal muscle). Consequently, in practice, experimental protocols often evolve organically within laboratory communities, based on direct observations and acquired practical knowhow. Interestingly, a recent meta-analysis of published measurements of specific force in skinned human skeletal muscle noted a greater consistency in the results obtained within research groups (defined in terms of commonalities in authorship) than between them (Kalakoutis et al., 2021). This observation could be interpreted as revealing a genealogy of sorts in the evolution of protocols that is at odds with rigorous and objective development, thereby possibly mitigating the appeal of the experiments altogether.Tempting as it may be to imagine a universally applicable method, we feel it would be counterproductive to seek to disentangle and confront the rationales of individual protocols, with the risk of dogmatically promoting one valid method among several. The very idea of a unique universal recipe, valid for all experiments, is indeed highly questionable. As a more fruitful approach, we instead present the following themes as set of general guiding principles for encouraging good experimental practice.Monitoring sarcomeric dynamicsGiven the importance of sarcomere length and interfilament dynamics in force generation, we recommend that mechanical force measurements be accompanied by the simultaneous measurement of striation patterns. This would include the mean sarcomere length and, ideally, an index of heterogeneity and/or stability. We recognize that these measurements may be particularly challenging in cardiac trabeculae.Fixing the pHEnsuring the constancy of pH is paramount for ensuring consistency in measurements. This is achieved by applying a suitable buffer, in many cases imidazole.Saturation with ATPA useful simplification of the experimental system is to ensure that the cross-bridge cycling kinetics is not rate-limited by ATP. In most cases, this can be achieved by using solutions with at least 4 mM free ATP.Careful control of [Ca2+]The importance of correctly determining the concentration of free Ca2+ cannot be sufficiently emphasized. Some laboratories use pCa solutions based on recipes that originate with Fabiato and Fabiato (1979) or Godt and Lindley (1982). Those wishing to make new recipes can consider using the MaxChelator software suite (Bers et al., 2010; Patton et al., 2004), which can provide appropriate stoichiometric concentrations of Ca2+, Mg2+, EGTA, and ATP for use in experimental solutions. A useful recipe for producing buffers with varying [Ca2+] is to prepare “low” and “high” reference buffers (e.g., with pCa = 9.0 and 4.5) and to mix them in appropriate proportions.Choice of temperatureGiven the importance of temperature as a determinant of muscle kinetics, it stands to reason that experiments should be done at physiological temperatures. However, a practical drawback is its destabilization of the sarcomere structure. Skeletal fibers have historically been measured at lower temperatures (sometimes even near above freezing) to ensure that preparations last the experiment duration. Many experiments on both skeletal and cardiac muscle can be done at 15°C. However, it is worth noting that rodent myocardium is more fragile than human (where room temperature or even 37°C is possible), possibly owing to differences in metabolic and ATPase rates. As a general recommendation, we would encourage experimentalists to choose temperatures that are nearest to physiological conditions where the preparation is stable. It is, however, perhaps even more important to only compare experimental results obtained at the same temperature.ConclusionThe aim of this review was to survey the benefits of skinned muscle measurements for characterizing cardiac muscle physiology, while highlighting intrinsic challenges for both the conduct and the interpretation of measurements. These features are summarized in Strengths• Direct access to the sarcomere system• Separation of cellular subsystems (e.g., sarcomeres versus sarcolemma)• Ability to use fluorescent probes and other analytic tools• Convenience of controllably performing different standardized experiments (e.g., isometric/isotonic contractions)• Ability to perform protein exchange experiments that preserve overall functionality (e.g., troponin; Babu et al., 1988; Brenner et al., 1999; Gulati and Babu, 1989); and to probe time-resolve sarcomere dynamics by photolysis of caged compounds (ATP [Goldman et al., 1982, 1984], inorganic phosphate [Araujo and Walker, 1996; Dantzig et al., 1992; Millar and Homsher, 1990; Tesi et al., 2000], and Ca2+ chelators [Luo et al., 2002; Wahr et al., 1998])• Simpler handling and storage logistics (samples can be thawed and analyzed after prior freezing) Weaknesses • Challenge of reproducing the native physiological environment• Variations in results between laboratories• Instability and sensitivity to temperature• Challenges of [Ca2+] calibration• Structural changes caused by skinning (e.g., altered sarcomere morphology, loss of cellular heterogeneity), impacting functional behaviorOpen in a separate windowThe potential pitfalls of mischaracterizing sarcomere behavior, based on skinned muscle measurements, are particularly exposed when considering the broader physiological context, where different cardiac subsystems operate simultaneously (Mosqueira et al., 2019; Niederer et al., 2019b). Pharmacological research increasingly exploits skinned muscle experiments to assess targeted drug action on sarcomeres (Dou et al., 2007; Edes et al., 1995; Fitton and Brogden, 1994; Hara et al., 1999; Kobayashi et al., 1991; Lamont and Miller, 1992; Lee and Allen, 1997; Lues et al., 1988; Scheld et al., 1989; Solaro and Rüegg, 1982; Sudo et al., 2001; Tadano et al., 2010). However, drug impact is notoriously multifaceted, and side effects, unseen in the isolated sarcomeres, may readily and unpredictably overwhelm intended effects (Lee and Allen, 1997; Lues et al., 1993). These side effects notwithstanding, the extrapolation of skinned-muscle measurements to the native cellular state and to systemic cardiac function encounters significant interpretational hurdles, as illustrated above.Skinned muscle measurements carry intrinsic uncertainty, as experiments performed using different animal models, temperatures, and protocols occasionally produce contradictory characterizations. Approximate quantitative accuracy is obviously highly problematic in the perspective of developing customized clinical care. This requirement is particularly important given the modular nature of models and the need to combine interacting subsystems on different length scales (Niederer et al., 2019a, 2019b). In practice, the interfacing of such modules normally requires ad hoc empirical alterations to model parameters, often relying on the modeler’s judgment (Hunter et al., 1998; Land et al., 2017). These choices are naturally often speculative.Despite these difficulties, it would be wrong to misrepresent the true potential of skinned-muscle experiments. Just as animal models are essential for investigating human physiology, skinned muscle provides an experimental setting with unique benefits. Biophysical modeling helps to formalize the conceptual basis for interpreting experimental data in terms of specific mechanisms (for example, an observed variation in pCa50 may result from changes to troponin binding kinetics or cross-bridge formation). Global sensitivity analyses allow a ranking of the relative importance of individual model parameters, thus providing a handle for guiding judgment in how to use measurement-derived parameters (Longobardi et al., 2020). In this perspective, the benefit of models is in providing a framework for formulating and testing hypotheses, rather than delivering fixed and absolute representations of the muscle system.The appeal of skinned muscle preparations is best appreciated by seeing them not as a direct emulation of real muscle, but rather as one further element in the physiologist’s experimental armory. This issue is well illustrated by Irving and Craig (2019) with reference to a loosening of the thick-filament structure induced by cardiac myosin-binding protein C phosphorylation. This effect was manifested as a structural change in skinned cardiac muscle but may be eclipsed in the compact and crowded conditions of intact muscle. In such circumstances, attempting to reconcile the experiments, even qualitatively, may seem futile. Yet the skinned-muscle effect may well be the telltale indicator of a genuine regulatory mechanism that would otherwise remain invisible and unmeasurable in the intact system. Rather than seeking a literal mirroring of these skinned and intact experiments at any cost, additional physiological insight might potentially be gained by further pursuing the experiments, and comparing their quantitative results in parallel, in other cell types or under different experimental conditions. Ultimately, the integration of experimental findings remains a continual process involving a balance of pragmaticism and biophysically guided scientific judgment.  相似文献   

3.
Imaging cell biology in live animals: Ready for prime time     
Roberto Weigert  Natalie Porat-Shliom  Panomwat Amornphimoltham 《The Journal of cell biology》2013,201(7):969-979
Time-lapse fluorescence microscopy is one of the main tools used to image subcellular structures in living cells. Yet for decades it has been applied primarily to in vitro model systems. Thanks to the most recent advancements in intravital microscopy, this approach has finally been extended to live rodents. This represents a major breakthrough that will provide unprecedented new opportunities to study mammalian cell biology in vivo and has already provided new insight in the fields of neurobiology, immunology, and cancer biology.The discovery of GFP combined with the ability to engineer its expression in living cells has revolutionized mammalian cell biology (Chalfie et al., 1994). Since its introduction, several light microscopy–based techniques have become invaluable tools to investigate intracellular events (Lippincott-Schwartz, 2011). Among them are: time-lapse confocal microscopy, which has been instrumental in studying the dynamics of cellular and subcellular processes (Hirschberg et al., 1998; Jakobs, 2006; Cardarelli and Gratton, 2010); FRAP, which has enabled determining various biophysical properties of proteins in living cells (Berkovich et al., 2011); and fluorescence resonance energy transfer (FRET), which has been used to probe for protein–protein interactions and the local activation of specific signaling pathways (Balla, 2009). The continuous search for improvements in temporal and spatial resolution has led to the development of more sophisticated technologies, such as spinning disk microscopy, which allows the resolution of fast cellular events that occur on the order of milliseconds (Nakano, 2002); total internal reflection microscopy (TIRF), which enables imaging events in close proximity (100 nm) to the plasma membrane (Cocucci et al., 2012); and super-resolution microscopy (SIM, PALM, and STORM), which captures images with resolution higher than the diffraction limit of light (Lippincott-Schwartz, 2011).Most of these techniques have been primarily applied to in vitro model systems, such as cells grown on solid substrates or in 3D matrices, explanted embryos, and organ cultures. These systems, which are relatively easy to maintain and to manipulate either pharmacologically or genetically, have been instrumental in providing fundamental information about cellular events down to the molecular level. However, they often fail to reconstitute the complex architecture and physiology of multicellular tissues in vivo. Indeed, in a live organism, cells exhibit a 3D organization, interact with different cell types, and are constantly exposed to a multitude of signals originated from the vasculature, the central nervous system, and the extracellular environment. For this reason, scientists have been attracted by the possibility of imaging biological processes in live multicellular organisms (i.e., intravital microscopy [IVM]). The first attempt in this direction was in 1839, when Rudolph Wagner described the interaction of leukocytes with the walls of blood vessels in the webbed feet of a live frog by using bright-field transillumination (Wagner, 1839). Since then, this approach has been used for over a century to study vascular biology in thin areas of surgically exposed organs (Irwin and MacDonald, 1953; Zweifach, 1954) or by implanting optical windows in the skin or the ears (Clark and Clark, 1932). In addition, cell migration has also been investigated using transparent tissues, such as the fin of the teleost (Wood and Thorogood, 1984; Thorogood and Wood, 1987). The introduction of epifluorescence microscopy has enabled following in more detail the dynamics of individual cells in circulation (Nuttall, 1987), in tumors (MacDonald et al., 1992), or in the immune system (von Andrian, 1996), and the spatial resolution has been significantly improved by the use of confocal microscopy, which has made it possible to collect serial optical sections from a given specimen (Villringer et al., 1989; O’Rourke and Fraser, 1990; Jester et al., 1991). However, these techniques can resolve structures only within a few micrometers from the surface of optically opaque tissues (Masedunskas et al., 2012a). It was only in the early nineteen nineties, with the development of multiphoton microscopy, that deep tissue imaging has become possible (Denk et al., 1990; Zipfel et al., 2003b), significantly contributing to several fields, including neurobiology, immunology, and cancer biology (Fig. 1; Svoboda and Yasuda, 2006; Amornphimoltham et al., 2011; Beerling et al., 2011). In the last few years, the development of strategies to minimize the motion artifacts caused by the heartbeat and respiration has made it possible to successfully image subcellular structures with spatial and temporal resolutions comparable to those achieved in in vitro model systems, thus providing the opportunity to study cell biology in live mammalian tissues (Fig. 1; Weigert et al., 2010; Pittet and Weissleder, 2011).Open in a separate windowFigure 1.Spatial resolution and current applications of intravital microscopy. IVM provides the opportunity to image several biological processes in live animals at different levels of resolution. Low-magnification objectives (5–10×) enable visualizing tissues and their components under physiological conditions and measuring their response under pathological conditions. Particularly, the dynamics of the vasculature have been one of topic most extensively studied by IVM. Objectives with higher magnification (20–30×) have enabled imaging the behavior of individual cell over long periods of time. This has led to major breakthroughs in fields such as neurobiology, immunology, cancer biology, and stem cell research. Finally, the recent developments of strategies to minimize the motion artifacts caused by the heartbeat and respiration combined with high power lenses (60–100×) have opened the door to image subcellular structures and to study cell biology in live animals.The aim of this review is to highlight the power of IVM in addressing cell biological questions that cannot be otherwise answered in vitro, due to the intrinsic limitations of reductionist models, or by other more classical approaches. Furthermore, we discuss limitations and areas for improvement of this imaging technique, hoping to provide cell biologists with the basis to assess whether IVM is the appropriate choice to address their scientific questions.

Imaging techniques currently used to perform intravital microscopy

Confocal and two-photon microscopy are the most widely used techniques to perform IVM. Confocal microscopy, which is based on single photon excitation, is a well-established technique (Fig. 2 A) that has been extensively discussed elsewhere (Wilson, 2002); hence we will only briefly describe some of the main features of two-photon microscopy and other nonlinear optical techniques.Open in a separate windowFigure 2.Fluorescent light microscopy imaging techniques used for intravital microscopy. (A) Confocal microscopy. (top) In confocal microscopy, a fluorophore absorbs a single photon with a wavelength in the UV-visible range of the spectrum (blue arrow). After a vibrational relaxation (orange curved arrow), a photon with a wavelength shifted toward the red is emitted (green arrow). (center) In thick tissue, excitation and emission occur in a relative large volume around the focal plane (F.P.). The off-focus emissions are eliminated through a pinhole, and the signal from the focal plane is detected via a photomultiplier (PMT). Confocal microscopy enables imaging at a maximal depth to 80–100 µm. (bottom) Confocal z stack of the tongue of a mouse expressing the membrane marker m-GFP (green) in the K14-positive basal epithelial layer, and the membrane marker mTomato in the endothelium (red). The xy view shows a maximal projection of 40 z slices acquired every 2.5 µm, whereas the xz view shows a lateral view of the stack. In blue are the nuclei labeled by a systemic injection of Hoechst. Excitation wavelengths: 450 nm, 488 nm, and 562 nm. (B) Two- and three-photon microscopy. (top) In this process a fluorophore absorbs almost simultaneously two or three photons that have half (red arrow) or a third (dark red arrow) of the energy required for its excitation with a single photon. Two- or three-photon excitations typically require near-IR or IR light (from 690 to 1,600 nm). (center) Emission and excitation occur only at the focal plane in a restricted volume (1.5 fl), and for this reason a pinhole is not required. Two- and three-photon microscopy enable imaging routinely at a maximal depth of 300–500 µm. (bottom) Two-photon z stack of an area adjacent to that imaged in A. xy view shows a maximal projection of 70 slices acquired every 5 µm. xz view shows a lateral view of the stack. Excitation wavelength: 840 nm. (C) SHG and THG. (top) In SHG and THG, photons interact with the specimen and combine to form new photons that are emitted with twice or three times their initial energy without any energy loss. (center) These processes have similar features to those described for two- and three-photon microscopy and enable imaging at a maximal depth of 200–400 µm. (bottom) z stack of a rat heart excited by two-photon microscopy (740 nm) to reveal the parenchyma (green), and SHG (930 nm) to reveal collagen fibers (red). xy shows a maximal projection of 20 slices acquired every 5 µm. xz view shows a lateral view of the stack. Bars: (xy views) 40 µm; (xz views) 50 µm.The first two-photon microscope (Denk et al., 1990) was based on the principle of two-photon excitation postulated by Maria Göppert-Mayer in her PhD thesis (Göppert-Mayer, 1931). In this process a fluorophore is excited by the simultaneous absorption of two photons with wavelengths in the near-infrared (IR) or IR spectrum (from 690 to 1,600 nm; Fig. 2 B). Two-photon excitation requires high-intensity light that is provided by lasers generating very short pulses (in the femtosecond range) and is focused on the excitation spot by high numerical aperture lenses (Zipfel et al., 2003b). There are three main advantages in using two-photon excitation for IVM. First, IR light has a deeper tissue penetration than UV or visible light (Theer and Denk, 2006). Indeed, two-photon microscopy can resolve structures up to a depth of 300–500 µm in most of the tissues (Fig. 2 B), and up to 1.5 mm in the brain (Theer et al., 2003; Masedunskas et al., 2012a), whereas confocal microscopy is limited to 80–100 µm (Fig. 2 A). Second, the excitation is restricted to a very small volume (1.5 fl; Fig. 2 B). This implies that in two-photon microscopy there is no need to eliminate off-focus signals, and that under the appropriate conditions photobleaching and phototoxicity are negligible (Zipfel et al., 2003b). However, confocal microscopy induces out-of-focus photodamage, and thus is less suited for long-term imaging. Third, selected endogenous molecules can be excited, thus providing the contrast to visualize specific biological structures without the need for exogenous labeling (Zipfel et al., 2003a). Some of these molecules can also be excited by confocal microscopy using UV light, although with the risk of inducing photodamage.More recently, other nonlinear optical techniques have been used for IVM, and among them are three-photon excitation, and second and third harmonic generation (SHG and THG; Campagnola and Loew, 2003; Zipfel et al., 2003b; Oheim et al., 2006). Three-photon excitation follows the same principle as two-photon (Fig. 2 B), and can reveal endogenous molecules such as serotonin and melatonin (Zipfel et al., 2003a; Ritsma et al., 2013). In SHG and THG, photons interact with the specimen and combine to form new photons that are emitted with two or three times their initial energy (Fig. 2 C). SHG reveals collagen (Fig. 2 C) and myosin fibers (Campagnola and Loew, 2003), whereas THG reveals lipid droplets and myelin fibers (Débarre et al., 2006; Weigelin et al., 2012). Recently, two other techniques have been used for IVM: coherent anti-Stokes Raman scattering (CARS) and fluorescence lifetime imaging (FLIM). CARS that is based on two laser beams combined to match the energy gap between two vibrational levels of the molecule of interest, has been used to image lipids and myelin fibers (Müller and Zumbusch, 2007; Fu et al., 2008; Le et al., 2010). FLIM, which measures the lifetime that a molecule spends in the excited state, provides quantitative information on cellular parameters such as pH, oxygen levels, ion concentration, and the metabolic state of various biomolecules (Levitt et al., 2009; Provenzano et al., 2009; Bakker et al., 2012).We want to emphasize that two-photon microscopy and the other nonlinear techniques are the obligatory choice when the imaging area is located deep inside the tissue, endogenous molecules have to be imaged, or long-term imaging with frequent sampling is required. However, confocal microscopy is more suited to resolve structures in the micrometer range, because of the possibility of modulating the optical slice (Masedunskas et al., 2012a).

IVM to investigate biological processes at the tissue and the single cell level

The main strength of IVM is to provide information on the dynamics of biological processes that otherwise cannot be reconstituted in vitro or ex vivo. Indeed, IVM has been instrumental in studying several aspects of tissue physiopathology (Fig. 3, A and B). Although other approaches such as classical immunohistochemistry, electron microscopy, and indirect immunofluorescence may provide detailed structural and quantitative information on blood vessels, IVM enables measuring events such as variations of blood flow at the level of the capillaries or local changes in blood vessel permeability. These data have been instrumental in understanding the mechanisms of ischemic diseases and tumor progression, and in designing effective anticancer treatments.

Table 1.

IVM to study tissue physiopathology
EventOrganProbesReference
Measurements of local blood flow and glial cell functionBrainDextranHelmchen and Kleinfeld, 2008
Ischemia and reperfusionBrainSulphorhodamine 101, DextranZhang and Murphy, 2007; Masamoto et al., 2012;
Glomerular filtration and tubular reabsorptionKidneyDextran, AlbuminKang et al., 2006; Yu et al., 2007; Camirand et al., 2011
Blood flow patternsPancreatic isletsDextranNyman et al., 2008
Capillary response and synaptic activationOlfactory bulbDextranChaigneau et al., 2003
Imaging angiogenesis during wound healingSkullcapDextranHolstein et al., 2011
Pulmonary microvasculature and endothelial activationLungDextranPresson et al., 2011
Morphology of blood vessels and permeability in tumorsXenograftsDextran, RGD quantum dotsTozer et al., 2005; Smith et al., 2008; Vakoc et al., 2009; Fukumura et al., 2010
Hepatic transport into the bile canaliculiLiverCarboxyfluorescein diacetate Rhodamine 123Babbey et al., 2012; Liu et al., 2012
Progression of amyloid plaques in Alzheimer’s diseaseBrainCurcumin and metoxy-04Spires et al., 2005; Garcia-Alloza et al., 2007
Mitochondrial membrane potentialLiverTetramethylrhodamine methyl ester Rhodamine 123Theruvath et al., 2008; Zhong et al., 2008
Oxygen consumptionLiverRu(phen3)2+Paxian et al., 2004
Sarcomere contraction in humansSkeletal muscleEndogenous fluorescenceLlewellyn et al., 2008
Open in a separate windowOpen in a separate windowFigure 3.Imaging tissues and individual cells in live animals. (A) The vasculature of an immunocompromised mouse was highlighted by the systemic injection of 2 MD dextran (red) before (left) and after (right) the implant of breast cancer cells in the back (green). Note the change in shape of the blood vessels and their increased permeability (arrow). Images were acquired by two-photon microscopy (excitation wavelength: 930 nm). (B) The microvasculature in the liver of a mouse expressing the membrane marker mTomato (red) was highlighted by the injection of cascade blue dextran (blue) and imaged by confocal microscopy (excitation wavelengths: 405 nm and 561 nm). Note the red blood cells that do not uptake the dye and appear as dark objects in the blood stream (arrow). (C) Metastatic and nonmetastatic human adenocarcinoma cells were injected in the tongue of an immunocompromised mouse and imaged for four consecutive days by using two-photon microscopy (excitation wavelength: 930 nm). The metastatic cells, which express the fluorescent protein mCherry (red), migrate away from the edge of the tumor (arrows), whereas the nonmetastatic cells, which express the fluorescent protein Venus (green), do not. (D) A granulocyte moving inside a blood vessel in the mammary gland of a mouse expressing GFP-tagged myosin IIb (green) and labeled with the mitochondrial vital dye MitoTracker (red) was imaged in time lapse by using confocal microscopy (excitation wavelengths: 488 nm and 561 nm). Figure corresponds to Video 1. Time is expressed as minutes:seconds. Bars: (A) 100 µm; (B) 10 µm; (C) 30 µm; (D) 10 µm.IVM has also been used successfully to study the dynamics and the morphological changes of individual cells within a tissue (EventOrganProbeReferenceNeuronal morphology of hippocampal neuronsBrainThy1-GFP mice, dextranBarretto et al., 2011Neuronal circuitryBrainBrainbow miceLivet et al., 2007Dendritic spine development in the cortexBrainYFP H-line micePan and Gan, 2008Calcium imaging in the brainBrainGCAMPZariwala et al., 2012Natural killer cell and cytotoxic T cell interactions with tumorsXenograftmCFP , mYFPDeguine et al., 2010Neutrophil recruitment in beating heartHeartDextran, CX3CR1-GFP miceLi et al., 2012Immune cells in the central nervous systemBrainDextran, CX3CR1-GFP, LysM-GFP and CD11c-YFP miceNayak et al., 2012Dendritic cells migrationSkinYFP, VE-caherin RFP mice, dextranNitschké et al., 2012CD8+ T cells interaction with dendritic cells during viral infectionLymph nodesEGFP, Dextran, SHGHickman et al., 2008B cells and dendritic cells interactions outside lymph nodesLymph nodesEGFPQi et al., 2006Change in gene expression during metastasisXenograftPinner et al., 2009Invasion and metastasis in head and neck cancerXenograftYFP, RFP-lifeact, dextranAmornphimoltham et al., 2013Fibrosarcoma cell migration along collagen fibersDorsal skin chamberSHG, EGFP, DsRed, DextranAlexander et al., 2008Long term imaging mammary tumors and photo-switchable probesMammary windowDendra-2Kedrin et al., 2008; Gligorijevic et al., 2009Long term imaging liver metastasis through abdominal windowLiverSHG, Dendra2, EGFPRitsma et al., 2012bMacrophages during intravasation in mammary tumorsXenograftEGFP, SHG, dextransWang et al., 2007; Wyckoff et al., 2007Melanoma collective migrationDorsal skin ChamberSHG, THG, EGFP, DextranWeigelin et al., 2012Hematopoietic stem cells and blood vesselSkullcupDextranLo Celso et al., 2009Epithelial stem cells during hair regenerationSkinH2B-GFP miceRompolas et al., 2012Open in a separate windowIn neurobiology, for example, the development of approaches to perform long-term in vivo imaging has permitted the correlation of changes in neuronal morphology and neuronal circuitry to pathological conditions such as stroke (Zhang and Murphy, 2007), tumors (Barretto et al., 2011), neurodegenerative diseases (Merlini et al., 2012), and infections (McGavern and Kang, 2011). This has been accomplished by the establishment of surgical procedures to expose the brain cortex, and the implantation of chronic ports of observations such as cranial windows and imaging guide tubes for micro-optical probes (Svoboda and Yasuda, 2006; Xu et al., 2007; Barretto et al., 2011). In addition, this field has thrived thanks to the development of several transgenic mouse models harboring specific neuronal populations expressing either one or multiple fluorescent molecules (Svoboda and Yasuda, 2006; Livet et al., 2007).In tumor biology, the ability to visualize the motility of cancer cells within a tumor in vivo has provided tremendous information on the mechanisms regulating invasion and metastasis (Fig. 3 C; Beerling et al., 2011). Tumor cells metastasize to distal sites by using a combination of processes, which include tumor outgrowth, vascular intravasation, lymphatic invasion, or migration along components of the extracellular matrix and nerve fibers. Although classical histological analysis and indirect immunofluorescence have been routinely used to study these processes, the ability to perform long-term IVM through the optimization of optical windows (Alexander et al., 2008; Kedrin et al., 2008; Gligorijevic et al., 2009; Ritsma et al., 2012b) has provided unique insights. For example, a longitudinal study performed by using a combination of two-photon microscopy, SHG, and THG has highlighted the fact that various tissue components associated with melanomas may play either a migration-enhancing or migration-impeding role during collective cell invasion (Weigelin et al., 2012). In mammary tumors, the intravasation of metastatic cells has been shown to require macrophages (Wang et al., 2007; Wyckoff et al., 2007). In head and neck cancer, cells have been shown to migrate from specific sites at the edge of the tumor, and to colonize the cervical lymph nodes by migrating though the lymphatic vessels (Fig. 3 C; Amornphimoltham et al., 2013). In highly invasive melanomas, the migratory ability of cells has been correlated with their differentiation state, as determined by the expression of a reporter for melanin expression (Pinner et al., 2009).Imaging the cells of the immune system in a live animal has revealed novel qualitative and quantitative aspects of the dynamics of cellular immunity (Fig. 2 C and Video 1; Germain et al., 2005; Cahalan and Parker, 2008; Nitschke et al., 2008). Indeed, the very complex nature of the immune response, the involvement of a multitude of tissue components, and its tight spatial and temporal coordination clearly indicate that IVM is the most suited approach to study cellular immunity. This is highlighted in studies either in lymphoid tissues, where the exquisite coordination between cell–cell interactions and cell signaling has been studied during the interactions of B lymphocytes and T cell lymphoid tissues (Qi et al., 2006), T cell activation (Hickman et al., 2008; Friedman et al., 2010), and migration of dendritic cells (Nitschké et al., 2012), or outside lymphoid tissues, such as, for example, brain during pathogen infections (Nayak et al., 2012), heart during inflammation (Li et al., 2012), and solid tumors (Deguine et al., 2010).

Imaging subcellular structures in vivo and its application to cell biology

The examples described so far convey that IVM has contributed to unraveling how the unique properties of the tissue environment in vivo significantly regulate the dynamics of individual cells and ultimately tissue physiology. Is IVM suitable to determine (1) how subcellular events occur in vivo, (2) whether they differ in in vitro settings, and (3), finally, the nature of their contribution to tissue physiology?IVM has been extensively used to image subcellular structures in smaller organisms (i.e., zebrafish, Caenorhabditis elegans) that are transparent and can be easily immobilized (Rohde and Yanik, 2011; Tserevelakis et al., 2011; Hove and Craig, 2012). In addition, the ability to easily perform genetic manipulations has made these systems extremely attractive to study several aspects of developmental and cell biology. However, their differences in term of organ physiology with respect to rodents do not make them suitable models for human diseases. For a long time, subcellular imaging in live rodents has been hampered by the motion artifacts derived from the heartbeat and respiration. Indeed, small shifts along the three axes make it practically impossible to visualize structures whose sizes are in the micrometer or submicrometer range, whereas it marginally affects larger structures. This issue has been only recently addressed by using a combination of strategies, which include: (1) the development of specific surgical procedures that allow the exposure and proper positioning of the organ of interest (Masedunskas et al., 2013), (2) the improvement of specific organ holders (Cao et al., 2012; Masedunskas et al., 2012a), and (3) the synchronization of the imaging acquisition with the heartbeat and respiration (Presson et al., 2011; Li et al., 2012). Very importantly, these approaches have been successfully implemented without compromising the integrity and the physiology of the tissue, thus opening the door to study cell biology in a live animal.For example, large subcellular structures such as the nuclei have been easily imaged, making it possible to study processes such as cell division and apoptosis (Fig. 4 A; Goetz et al., 2011; Orth et al., 2011; Rompolas et al., 2012). Interestingly, these studies have highlighted the fact that the in vivo microenvironment substantially affects nuclear dynamics. Indeed, mitosis and the structure of the mitotic spindle were followed over time in a xenograft model of human cancer expressing the histone marker mCherry-H2B and GFP-tubulin (Orth et al., 2011). Specifically, the effects of the anticancer drug Paclitaxel were studied, revealing that the tumor cells in vivo have a higher mitotic index and lower pro-apoptotic propensity than in vitro (Orth et al., 2011). FRET has been used in subcutaneous tumors to image cytotoxic T lymphocyte–induced apoptosis and highlighted that the kinetics of this process are much slower than those reported for nontumor cells in vivo that are exposed to a different microenvironment (Breart et al., 2008). Cell division has also been followed in the hair-follicle stem cells of transgenic mice expressing GFP-H2B. This study determined that epithelial–mesenchymal interactions are essential for stem cell activation and regeneration, and that nuclear divisions occur in a specific area of the hair follicles and are oriented toward the axis of growth (Rompolas et al., 2012). These processes show an extremely high level of temporal and spatial organization that can only be appreciated in vivo and by using time-lapse imaging.Open in a separate windowFigure 4.Imaging subcellular events in live animals. (A) Human squamous carcinoma cells were engineered to stably express the Fucci cell cycle reporter into the nucleus and injected in the back of an immunocompromised mouse. After 1 wk, the tumor was imaged by two-photon microscopy and SHG (excitation wavelength: 930 nm). (top) Maximal projection of a z stack (xy view). Cells in G2/M are in green, cells in G1 are in red, and collagen fibers are in cyan. (bottom) Lateral view (xz) of a z stack. (B) Clusters of GLUT4-containing vesicles (green) in the soleus muscle of a transgenic mouse expressing GFP-GLUT4 and injected with 70 kD Texas red–dextran to visualize the vasculature and imaged by two-photon microscopy (excitation wavelength: 930 nm). (C) Confocal microscopy (excitation wavelength: 488 nm) of hepatocytes in the liver of a transgenic mouse expressing the autophagy marker GFP-LC3. The inset shows small GFP-LC3 autophagic vesicles. (D–G) Dynamics of intracellular compartments imaged by time-lapse two-photon (E) or confocal microscopy (D, F, and G). (D) Endocytosis of systemically injected 10 kD Texas red–dextran into the kidney of a transgenic mouse expressing the membrane marker m-GFP. The dextran (red) is transported from the microvasculature into the proximal tubuli, and then internalized in small endocytic vesicles (arrows; Video 2). (E) Endocytosis of a systemically injected 10 kD of Alexa Fluor 488 dextran into the salivary glands of a live rat. The dextran (green) diffuses from the vasculature into the stroma, and it is internalized by stromal cells (insets). Collagen fibers (red) are highlighted by SHG. (F) Regulated exocytosis of large secretory granules in the salivary glands of a live transgenic mouse expressing cytoplasmic GFP. The GFP is excluded from the secretory granules and accumulates on their limiting membranes (arrows) after fusion with the plasma membrane (broken lines). The gradual collapse of an individual granule is highlighted in the insets. (G) Dynamics of mitochondria labeled with the membrane potential dye TMRM in the salivary glands of a live mouse. Time is expressed as minutes:seconds. Bars: (A) 40 µm; (B) 15 µm; (C, D, E, and G) 10 µm; (F) 5 µm.Imaging membrane trafficking has been more challenging because of its dynamic nature and the size of the structures to image. The first successful attempt to visualize membrane traffic events was achieved in the kidney of live rats by using two-photon microscopy where the endocytosis of fluid-phase markers, such as dextrans, or the receptor-mediated uptake of folate, albumin, and the aminoglycoside gentamicin were followed in the proximal tubuli (Fig. 4 D and Video 2; Dunn et al., 2002; Sandoval et al., 2004; Russo et al., 2007). These pioneering studies showed for the first time that apical uptake is involved in the filtration of large molecules in the kidney, whereas previously it was believed to be exclusively due to a barrier in the glomerular capillary wall. However, in the kidney the residual motion artifacts limited the imaging to short periods of time. Recently, the salivary glands have proven to be a suitable organ to study the dynamics of membrane trafficking by using either two-photon or confocal microscopy. Systemically injected dextrans, BSA, and transferrin were observed to rapidly internalize in the stromal cells surrounding the salivary gland epithelium in a process dependent on the actin cytoskeleton (Masedunskas and Weigert, 2008; Masedunskas et al., 2012b). Moreover, the trafficking of these molecules through the endo-lysosomal system was documented, providing interesting insights on early endosomal fusion (Fig. 4 E; Masedunskas and Weigert, 2008; Masedunskas et al., 2012b). Notably, significant differences were observed in the kinetics of internalization of transferrin and dextran. In vivo, dextran was rapidly internalized by stromal cells, whereas transferrin appeared in endosomal structures after 10–15 min. However, in freshly explanted stromal cells adherent on glass, transferrin was internalized within 1 min, whereas dextran appeared in endosomal structures after 10–15 min. Although the reasons for this difference were not addressed, it is clear that the environment in vivo has profound effects on the regulation of intracellular processes (Masedunskas et al., 2012b). Similar differences have been reported for the caveolae that in vivo are more dynamic than in cell cultures (Thomsen et al., 2002; Oh et al., 2007). Endocytosis has also been investigated in the epithelium of the salivary glands (Sramkova et al., 2009). Specifically, plasmid DNA was shown to be internalized by a clathrin-independent pathway from the apical plasma membrane of acinar and ductal cells, and to subsequently escape from the endo-lysosomal system, thus providing useful information on the mechanisms of nonviral gene delivery in vivo (Sramkova et al., 2012). Receptor-mediated endocytosis has also been studied in cancer models. Indeed, the uptake of a fluorescent EGF conjugated to carbon nanotubes has been followed in xenografts of head and neck cancer cells revealing that the internalization occurs primarily in cells that express high levels of EGFR (Bhirde et al., 2009). The role of endosomal recycling has also been investigated during tumor progression. Indeed, the small GTPase Rab25 was found to regulate the ability of head neck cancer cells to migrate to lymph nodes by controlling the dynamic assembly of plasma membrane actin reach protrusion in vivo (Amornphimoltham et al., 2013). Interestingly, this activity of Rab25 was reconstituted in cells migrating through a 3D collagen matrix but not in cells grown adherent to a solid substrate.IVM has been a powerful tool in investigating the molecular machinery controlling regulated exocytosis in various organs. In salivary glands, the use of selected transgenic mice expressing either soluble GFP or a membrane-targeted peptide has permitted the characterization of the dynamics of exocytosis of the secretory granules after fusion with the plasma membrane (Fig. 4 E; Masedunskas et al., 2011a, 2012d). These studies revealed that the regulation and the modality of exocytosis differ between in vivo and in vitro systems. Indeed, in vivo, regulated exocytosis is controlled by stimulation of the β-adrenergic receptor, and secretory granules undergo a gradual collapse after fusion with the apical plasma membrane, whereas, in vitro, regulated exocytosis is also controlled by the muscarinic receptor and the secretory granules fuse to each other, forming strings of interconnected vesicles at the plasma membrane (compound exocytosis; Masedunskas et al., 2011a, 2012d). Moreover, the transient expression of reporter molecules for F-actin has revealed the requirement for the assembly of an actomyosin complex to facilitate the completion of the exocytic process (Masedunskas et al., 2011a, 2012d). This result underscores the fact that the dynamics of the assembly of the actin cytoskeleton can be studied both qualitatively and quantitatively in live animals at the level of individual secretory granules. In addition, this approach has highlighted some of the mechanisms that contribute to regulate the apical plasma membrane homeostasis in vivo that cannot be recapitulated in an in vitro model systems (Masedunskas et al., 2011b, 2012c; Porat-Shliom et al., 2013). Indeed, the hydrostatic pressure that is built inside the ductal system by the secretion of fluids that accompanies exocytosis plays a significant role in controlling the dynamics of secretory granules at the apical plasma membrane. This aspect has never been appreciated in organ explants where the integrity of the ductal system is compromised. Finally, a very promising model has been developed in the skeletal muscle, where the transient transfection of a GFP-tagged version of the glucose transporter type 4 (GLUT4) has made possible to characterize the kinetics of the GLUT4-containing vesicles in resting conditions and their insulin-dependent translocation to the plasma membrane (Fig. 4 B; Lauritzen et al., 2008, 2010). This represents a very powerful experimental model that bridges together physiology and cell biology and has the potential to provide fundamental information on metabolic diseases.These examples underscore the merits of subcellular IVM to investigate specific areas of cell biology such as membrane trafficking, the cell cycle, apoptosis, and cytoskeletal organization. However, IVM is rapidly extending to other areas, such as cell signaling (Stockholm et al., 2005; Rudolf et al., 2006; Ritsma et al., 2012a), metabolism (Fig. 4 C; Débarre et al., 2006; Cao et al., 2012), mitochondrial dynamics (Fig. 4 F; Sun et al., 2005; Hall et al., 2013), or gene and protein expression (Pinner et al., 2009) that have just begun to be explored.

Future perspectives

IVM has become a powerful tool to study biological processes in live animals that is destined to have an enormous impact on cell biology. The examples described here give a clear picture of the broad applicability of this approach. In essence, we foresee that IVM is going to be the obligatory choice to study highly dynamic subcellular processes that cannot be reconstituted in vitro or ex vivo, or when a link between cellular events and tissue physiopathology is being pursued. In addition, IVM will provide the opportunity to complement and confirm data generated from in vitro studies. Importantly, the fact that in several instances confocal microscopy can be effectively used for subcellular IVM makes this approach immediately accessible to several investigators.In terms of future directions, we envision that other light microscopy techniques will soon become standard tools for in vivo studies, as shown by the recent application of FRET to study signaling (Stockholm et al., 2005; Rudolf et al., 2006; Breart et al., 2008; Ritsma et al., 2012a), and FRAP, which has been used in the live brain to measure the diffusion of α synuclein, thus opening the door to studying the biophysical properties of proteins in vivo (Unni et al., 2010). Moreover, super-resolution microscopy may be applied for imaging live animals, although this task may pose some challenges. Indeed, these techniques require: (1) the complete stability of the specimen, (2) extended periods of time for light collection, (3) substantial modifications to the existing microscopes, and (4) the generation of transgenic mice expressing photoactivatable probes.To reach its full potential, IVM has to further develop two main aspects: animal models and instrumentations. Indeed, a significant effort has to be invested in developing novel transgenic mouse models, which express fluorescently labeled reporter molecules. One example is the recently developed mouse that expresses fluorescently tagged lifeact. This model will provide the unique opportunity to study F-actin dynamics in vivo in the context of processes such as cell migration and membrane trafficking (Riedl et al., 2010). Moreover, the possibility of crossing these reporter mice with knockout animals will provide the means to further study cellular processes at a molecular level. Alternatively, reporter molecules or other transgenes that may perturb a specific cellular pathway can be transiently transfected into live animals in several ways. Indeed, the remarkable advancements in gene therapy have contributed to the development of several nonviral- and viral-mediated strategies for gene delivery to selected target organs. In this respect, the salivary glands and the skeletal muscle are two formidable model systems because either transgenes or siRNAs can be successfully delivered without any adverse reaction and expressed in a few hours. In terms of the current technical limitations of IVM, the main areas of improvement are the temporal resolution, the ability to access the organ of interest with minimal invasion, and the ability to perform long-term imaging. As for the temporal resolution, the issue has begun to be addressed by using two different approaches: (1) the use of spinning disk microscopy, as shown by its recent application to image platelet dynamics in live mice (Jenne et al., 2011); and (2) the development of confocal and two-photon microscopes equipped with resonant scanners that permit increasing the scanning speed to 30 frames per second (Kirkpatrick et al., 2012). As for accessing the organs, recently several microlenses (350 µm in diameter) have been inserted or permanently implanted into live animals, minimizing the exposure of the organs and the risk of affecting their physiology (Llewellyn et al., 2008). Finally, although some approaches for the long-term imaging of the brain, the mammary glands, and the liver have been developed, additional effort has to be devoted to establish chronic ports of observations in other organs.In conclusion, these are truly exciting times, and a new era full of novel discoveries is just around the corner. The ability to see processes inside the cells of a live animal is no longer a dream.

Online supplemental material

Video 1 shows time-lapse confocal microscopy of a granulocyte moving inside a blood vessel in the mammary gland of a mouse expressing GFP-tagged myosin IIb (green) and labeled with MitoTracker (red). Video 2 shows time-lapse confocal microscopy of the endocytosis of systemically injected 10 kD Texas red–dextran (red) into the kidney-proximal tubuli of a transgenic mouse expressing the membrane marker m-GFP (green). Online supplemental material is available at http://www.jcb.org/cgi/content/full/jcb.201212130/DC1.  相似文献   

4.
Root System Markup Language: Toward a Unified Root Architecture Description Language   总被引:1,自引:0,他引:1  
Guillaume Lobet  Michael P. Pound  Julien Diener  Christophe Pradal  Xavier Draye  Christophe Godin  Mathieu Javaux  Daniel Leitner  Félicien Meunier  Philippe Nacry  Tony P. Pridmore  Andrea Schnepf 《Plant physiology》2015,167(3):617-627
  相似文献   

5.
The cell biology of disease: Lysosomal storage disorders: The cellular impact of lysosomal dysfunction     
Frances M. Platt  Barry Boland  Aarnoud C. van der Spoel 《The Journal of cell biology》2012,199(5):723-734
  相似文献   

6.
Variation in Adult Plant Phenotypes and Partitioning among Seed and Stem-Borne Roots across Brachypodium distachyon Accessions to Exploit in Breeding Cereals for Well-Watered and Drought Environments     
Vincent Chochois  John P. Vogel  Gregory J. Rebetzke  Michelle Watt 《Plant physiology》2015,168(3):953-967
Seedling roots enable plant establishment. Their small phenotypes are measured routinely. Adult root systems are relevant to yield and efficiency, but phenotyping is challenging. Root length exceeds the volume of most pots. Field studies measure partial adult root systems through coring or use seedling roots as adult surrogates. Here, we phenotyped 79 diverse lines of the small grass model Brachypodium distachyon to adults in 50-cm-long tubes of soil with irrigation; a subset of 16 lines was droughted. Variation was large (total biomass, ×8; total root length [TRL], ×10; and root mass ratio, ×6), repeatable, and attributable to genetic factors (heritabilities ranged from approximately 50% for root growth to 82% for partitioning phenotypes). Lines were dissected into seed-borne tissues (stem and primary seminal axile roots) and stem-borne tissues (tillers and coleoptile and leaf node axile roots) plus branch roots. All lines developed one seminal root that varied, with branch roots, from 31% to 90% of TRL in the well-watered condition. With drought, 100% of TRL was seminal, regardless of line because nodal roots were almost always inhibited in drying topsoil. Irrigation stimulated nodal roots depending on genotype. Shoot size and tillers correlated positively with roots with irrigation, but partitioning depended on genotype and was plastic with drought. Adult root systems of B. distachyon have genetic variation to exploit to increase cereal yields through genes associated with partitioning among roots and their responsiveness to irrigation. Whole-plant phenotypes could enhance gain for droughted environments because root and shoot traits are coselected.Adult plant root systems are relevant to the size and efficiency of seed yield. They supply water and nutrients for the plant to acquire biomass, which is positively correlated to the harvest index (allocation to seed grain), and the stages of flowering and grain development. Modeling in wheat (Triticum aestivum) suggested that an extra 10 mm of water absorbed by such adult root systems during grain filling resulted in an increase of approximately 500 kg grain ha−1 (Manschadi et al., 2006). This was 25% above the average annual yield of wheat in rain-fed environments of Australia. This number was remarkably close to experimental data obtained in the field in Australia (Kirkegaard et al., 2007). Together, these modeling and field experiments have shown that adult root systems are critical for water absorption and grain yield in cereals, such as wheat, emphasizing the importance of characterizing adult root systems to identify phenotypes for productivity improvements.Most root phenotypes, however, have been described for seedling roots. Seedling roots are essential for plant establishment, and hence, the plant’s potential to set seed. For technical reasons, seedlings are more often screened than adult plants because of the ease of handling smaller plants and the high throughput. Seedling-stage phenotyping may also improve overall reproducibility of results because often, growth media are soil free. Seedling soil-free root phenotyping conditions are well suited to dissecting fine and sensitive mechanisms, such as lateral root initiation (Casimiro et al., 2003; Péret et al., 2009a, 2009b). A number of genes underlying root processes have been identified or characterized using seedlings, notably with the dicotyledonous models Arabidopsis (Arabidopsis thaliana; Mouchel et al., 2004; Fitz Gerald et al., 2006; Yokawa et al., 2013) and Medicago truncatula (Laffont et al., 2010) and the cereals maize (Zea mays; Hochholdinger et al., 2001) and rice (Oryza sativa; Inukai et al., 2005; Kitomi et al., 2008).Extrapolation from seedling to adult root systems presents major questions (Hochholdinger and Zimmermann, 2008; Chochois et al., 2012; Rich and Watt, 2013). Are phenotypes in seedling roots present in adult roots given developmental events associated with aging? Is expression of phenotypes correlated in seedling and adult roots if time compounds effects of growth rates and growth conditions on roots? Watt et al. (2013) showed in wheat seedlings that root traits in the laboratory and field correlated positively but that neither correlated with adult root traits in the field. Factors between seedling and adult roots seemed to be differences in developmental stage and the time that growing roots experience the environment.Seedling and adult root differences may be larger in grasses than dicotyledons. Grass root systems have two developmental components: seed-borne (seminal) roots, of which a number emerge at germination and continue to grow and branch throughout the plant life, and stem-borne (nodal or adventitious) roots, which emerge from around the three-leaf stage and continue to emerge, grow, and branch throughout the plant life. Phenotypes and traits of adult root systems of grasses, which include the major cereal crops wheat, rice, and maize, are difficult to predict in seedling screens and ideally identified from adult root systems first (Gamuyao et al., 2012).Phenotyping of adult roots is possible in the field using trenches (Maeght et al., 2013) or coring (Wasson et al., 2014). A portion of the root system is captured with these methods. Alternatively, entire adult root systems can be contained within pots dug into the ground before sowing. These need to be large; field wheat roots, for example, can reach depths greater than 1.5 m depending on genotype and environment. This method prevents root-root interactions that occur under normal field sowing of a plant canopy and is also a compromise.A solution to the problem of phenotyping adult cereal root systems is a model for monocotyledon grasses: Brachypodium distachyon. B. distachyon is a small-stature grass with a small genome that is fully sequenced (Vogel et al., 2010). It has molecular tools equivalent to those available in Arabidopsis (Draper et al., 2001; Brkljacic et al., 2011; Mur et al., 2011). The root system of B. distachyon reference line Bd21 is more similar to wheat than other model and crop grasses (Watt et al., 2009). It has a seed-borne primary seminal root (PSR) that emerges from the embryo at seed germination and multiple stem-borne coleoptile node axile roots (CNRs) and leaf node axile roots (LNRs), also known as crown roots or adventitious roots, that emerge at about three leaves through to grain development. Branch roots emerge from all root types. There are no known anatomical differences between root types of wheat and B. distachyon (Watt et al., 2009). In a recent study, we report postflowering root growth in B. distachyon line Bd21-3, showing that this model can be used to answer questions relevant to the adult root systems of grasses (Chochois et al., 2012).In this study, we used B. distachyon to identify adult plant phenotypes related to the partitioning among seed-borne and stem-borne shoots and roots for the genetic improvement of well-watered and droughted cereals (Fig. 1; Krassovsky, 1926; Navara et al., 1994), nitrogen, phosphorus (Tennant, 1976; Brady et al., 1995), oxygen (Wiengweera and Greenway, 2004), soil hardness (Acuna et al., 2007), and microorganisms (Sivasithamparam et al., 1978). Of note is the study by Krassovsky (1926), which was the first, to our knowledge, to show differences in function related to water. Krassovsky (1926) showed that seminal roots of wheat absorbed almost 2 times the water as nodal roots per unit dry weight but that nodal roots absorbed a more diluted nutrient solution than seminal roots. Krassovsky (1926) also showed by removing seminal or nodal roots as they emerged that “seminal roots serve the main stem, while nodal roots serve the tillers” (Krassovsky, 1926). Volkmar (1997) showed, more recently, in wheat that nodal and seminal roots may sense and respond to drought differently. In millet (Pennisetum glaucum) and sorghum (Sorghum bicolor), Rostamza et al. (2013) found that millet was able to grow nodal roots in a dryer soil than sorghum, possibly because of shoot and root vigor.Open in a separate windowFigure 1.B. distachyon plant scanned at the fourth leaf stage, with the root and shoot phenotypes studied indicated. Supplemental Table S1.
PhenotypeAbbreviationUnitRange of Variation
All Experiments (79 Lines and 582 Plants)Experiment 6 (36 Lines)
Whole plant
TDWTDWMilligrams88.6–773.8 (×8.7)285.6–438 (×1.5)
Shoot
SDWSDWMilligrams56.4–442.5 (×7.8)78.2–442.5 (×5.7)
 No. of tillersTillerNCount2.8–20.3 (×7.4)10–20.3 (×2)
Total root system
TRLTRLCentimeters1,050–10,770 (×10.3)2,090–5,140 (×2.5)
RDWRDWMilligrams28.9–312.17 (×10.8)62.2–179.1 (×2.9)
RootpcRootpcPercentage (of TDW)20.5–60.6 (×3)20.5–44.3 (×2.2)
R/SR/SUnitless ratio0.26–1.54 (×6)0.26–0.80 (×3.1)
PSRs
 Length (including branch roots)PSRLCentimeters549.1–4,024.6 (×7.3)716–2,984 (×4.2)
PSRpcPSRpcPercentage (of TRL)14.9–94.1 (×6.3)31.3–72.3 (×2.3)
 No. of axile rootsPSRcountCount11
 Length of axile rootPSRsumCentimeters17.45–52 (×3)17.45–30.3 (×1.7)
 Branch rootsPSRbranchCentimeters · (centimeters of axile root)−119.9–109.3 (×5.5)29.3–104.3 (×3.6)
CNRs
 Length (including branch roots)CNRLCentimeters0–3,856.70–2,266.5
CNRpcCNRpcPercentage (of TRL)0–57.10–49.8
 No. of axile rootsCNRcountCount0–20–2
 Cumulated length of axile rootsCNRsumCentimeters0–113.90–47.87
 Branch rootsCNRbranchCentimeters · (centimeters of axile root)−10–77.80–77.8
LNRs
 Length (including branch roots)LNRLCentimeters99.5–5,806.5 (×58.5)216.1–2,532.4 (×11.7)
LNRpcLNRpcPercentage (of TRL)4.2–72.7 (×17.5)6–64.8 (×10.9)
LNRcountLNRcountCount2–22.2 (×11.1)3.3–15.3 (×4.6)
LNRsumLNRsumCentimeters25.9–485.548–232 (×4.8)
 Branch rootsLNRbranchCentimeters · (centimeters of axile root)−12.1–25.4 (×12.1)3.2–15.9 (×5)
Open in a separate windowThe third reason for dissecting the different root types in this study was that they seem to have independent genetic regulation through major genes. Genes affecting specifically nodal root growth have been identified in maize (Hetz et al., 1996; Hochholdinger and Feix, 1998) and rice (Inukai et al., 2001, 2005; Liu et al., 2005, 2009; Zhao et al., 2009; Coudert et al., 2010; Gamuyao et al., 2012). Here, we also dissect branch (lateral) development on the seminal or nodal roots. Genes specific to branch roots have been identified in Arabidopsis (Casimiro et al., 2003; Péret et al., 2009a), rice (Hao and Ichii, 1999; Wang et al., 2006; Zheng et al., 2013), and maize (Hochholdinger and Feix, 1998; Hochholdinger et al., 2001; Woll et al., 2005).This study explored the hypothesis that adult root systems of B. distachyon contain genotypic variation that can be exploited through phenotyping and genotyping to increase cereal yields. A selection of 79 wild lines of B. distachyon from various parts of the Middle East (Fig. 2 shows the geographic origins of the lines) was phenotyped. They were selected for maximum genotypic diversity from 187 diploid lines analyzed with 43 simple sequence repeat markers (Vogel et al., 2009). We phenotyped shoots and mature root systems concurrently because B. distachyon is small enough to complete its life cycle in relatively small pots of soil with minimal influence of pot size compared with crops, such as wheat. We further phenotyped a subset of this population under irrigation (well watered) and drought to assess genotype response to water supply. By conducting whole-plant studies, we aimed to identify phenotypes that described partitioning among shoot and root components and within seed-borne and stem-borne roots. Phenotypes that have the potential to be beneficial to shoot and root components may speed up genetic gain in future.Open in a separate windowFigure 2.B. distachyon lines phenotyped in this study and their geographical origin. Capital letters in parentheses indicate the country of origin: Turkey (T), Spain (S), and Iraq (I; Vogel et al., 2009). a, Adi3, Adi7, Adi10, Adi12, Adi13, and Adi15; b, Bd21 and Bd21-3 are the reference lines of this study. Bd21 was the first sequenced line (Vogel et al., 2010) and root system (described in detail in Watt et al., 2009), and Bd21-3 is the most easily transformed line (Vogel and Hill, 2008) and parent of a T-DNA mutant population (Bragg et al., 2012); c, Gaz1, Gaz4, and Gaz7; d, Kah1, Kah2, and Kah3. e, Koz1, Koz3, and Koz5; f, Tek1 and Tek6; g, exact GPS coordinates are unknown for lines Men2 (S), Mur2 (S), Bd2.3 (I), Bd3-1 (I), and Abr1 (T).  相似文献   

7.
Peaks cloaked in the mist: The landscape of mammalian replication origins     
Olivier Hyrien 《The Journal of cell biology》2015,208(2):147-160
  相似文献   

8.
The cell biology of disease: The cellular and molecular basis for malaria parasite invasion of the human red blood cell     
Alan F. Cowman  Drew Berry  Jake Baum 《The Journal of cell biology》2012,198(6):961-971
  相似文献   

9.
Mouse Models of Osteoarthritis: A Summary of Models and Outcomes Assessment     
Sabine Drevet  Bertrand Favier  Emmanuel Brun  Gaëtan Gavazzi  Bernard Lardy 《Comparative medicine》2022,72(1):3
Osteoarthritis (OA) is a multidimensional health problem and a common chronic disease. It has a substantial impact on patient quality of life and is a common cause of pain and mobility issues in older adults. The functional limitations, lack of curative treatments, and cost to society all demonstrate the need for translational and clinical research. The use of OA models in mice is important for achieving a better understanding of the disease. Models with clinical relevance are needed to achieve 2 main goals: to assess the impact of the OA disease (pain and function) and to study the efficacy of potential treatments. However, few OA models include practical strategies for functional assessment of the mice. OA signs in mice incorporate complex interrelations between pain and dysfunction. The current review provides a comprehensive compilation of mouse models of OA and animal evaluations that include static and dynamic clinical assessment of the mice, merging evaluation of pain and function by using automatic and noninvasive techniques. These new techniques allow simultaneous recording of spontaneous activity from thousands of home cages and also monitor environment conditions. Technologies such as videography and computational approaches can also be used to improve pain assessment in rodents but these new tools must first be validated experimentally. An example of a new tool is the digital ventilated cage, which is an automated home-cage monitor that records spontaneous activity in the cages.

Osteoarthritis (OA) is a multidimensional health problem and a common chronic disease.36 Functional limitations, the absence of curative treatments, and the considerable cost to society result in a substantial impact on quality of life.76 Historically, OA has been described as whole joint and whole peri-articular diseases and as a systemic comorbidity.9,111 OA consists of a disruption of articular joint cartilage homeostasis leading to a catabolic pathway characterized by chondrocyte degeneration and destruction of the extracellular matrix (ECM). Low-grade chronic systemic inflammation is also actively involved in the process.42,92 In clinical practice, mechanical pain, often accompanied by a functional decline, is the main reason for consultations. Recommendations to patients provide guidance for OA management.22, 33,49,86 Evidence-based consensus has led to a variety of pharmacologic and nonpharmacologic modalities that are intended to guide health care providers in managing symptomatic patients. Animal-based research is of tremendous importance for the study of early diagnosis and treatment, which are crucial to prevent the disease progression and provide better care to patients.The purpose of animal-based OA research is 2-fold: to assess the impact of the OA disease (pain and function) and to study the efficacy of a potential treatment.18,67 OA model species include large animals such as the horse, goat, sheep, and dog, whose size and anatomy are expected to better reflect human joint conditions. However, small animals such as guinea pig, rabbit, mouse, and rat represent 77% of the species used.1,87 In recent years, mice have become the most commonly used model for studying OA. Mice have several advantageous characteristics: a short development and life span, easy and low-cost breeding and maintenance, easy handling, small joints that allow histologic analysis of the whole joint,32 and the availability of genetically modified lines.108 Standardized housing, genetically defined strains and SPF animals reduce the genetic and interindividual acquired variability. Mice are considered the best vertebrate model in terms of monitoring and controlling environmental conditions.7,14,15,87 Mouse skeletal maturation is reached at 10 wk, which theoretically constitutes the minimal age at which mice should be entered into an OA study.64,87,102 However, many studies violate this limit by testing mice at 8 wk of age.Available models for OA include the following (32,111 physical activity and exercise induced OA; noninvasive mechanical loading (repetitive mild loading and single-impact injury); and surgically induced (meniscectomy models or anterior cruciate ligament transection). The specific model used would be based on the goal of the study.7 For example, OA pathophysiology, OA progression, and OA therapies studies could use spontaneous, genetic, surgical, or noninvasive models. In addition, pain studies could use chemical models. Lastly, post-traumatic studies would use surgical or noninvasive models; the most frequently used method is currently destabilization of the medial meniscus,32 which involves transection of the medial meniscotibial ligament, thereby destabilizing the joint and causing instability-driven OA. An important caveat for mouse models is that the mouse and human knee differ in terms of joint size, joint biomechanics, and histologic characteristics (layers, cellularity),32,64 and joint differences could confound clinical translation.10 Table 1. Mouse models of osteoarthritis.
ModelsProsCons
SpontaneousWild type mice7,9,59,67,68,70,72,74,80,85,87,115,118,119,120- Model of aging phenotype
- The less invasive model
- Physiological relevance: mimics human pathogenesis
- No need for technical expertise
- No need for specific equipment
- Variability in incidence
- Large number of animals at baseline
- Long-term study: Time consuming (time of onset: 4 -15 mo)
- Expensive (husbandry)
Genetically modified mice2,7,25,40,50,52,67,72,79,80, 89,120- High incidence
- Earlier time of onset: 18 wk
- No need for specific equipment
- Combination with other models
- Time consuming for the strain development
- Expensive
Chemical- inducedMono-iodoacetate injection7,11,46,47,60,66,90,91,101,128- Model of pain-like phenotype
- To study mechanism of pain and antalgic drugs
- Short-term study: Rapid progression (2-7 wk)
- Reproducible
- Low cost
- Need for technical expertise
- Need for specific equipment
- Systemic injection is lethal
- Destructive effect: does not allow to study the early phase of pathogenesis
Papain injection66,67,120- Short-term study: rapid progression
- Low cost
- Need for technical expertise
- Need for specific equipment
- Does not mimic natural pathogenesis
Collagenase injection7,65,67,98- Short-term study: rapid progression (3 wk)
- Low cost
- Need for technical expertise
- Need for specific equipment
- Does not mimic natural pathogenesis
Non-invasiveHigh-fat diet (Alimentary induced obesity model)5,8,43,45,57,96,124Model of metabolic phenotype
No need for technical expertise
No need for specific equipment
Reproducible
Long-term study: Time consuming (8 wk–9 mo delay)
Expensive
Physical activity and exercise model45,73Model of post traumatic phenotype
No need for technical expertise
Long-term study: time consuming (18 mo delay)
Expensive
Disparity of results
Mechanical loading models Repetitive mild loading models Single-impact injury model7,16,23,24, 32,35,104,105,106Model of post traumatic phenotype
Allow to study OA development
Time of onset: 8-10 wk post injury
Noninvasive
Need for technical expertise
Need for specific equipment
Heterogeneity in protocol practices
Repetitive anesthesia required or ethical issues
SurgicalOvariectomy114Contested.
Meniscectomy model7,32,63,67,87 Model of post traumatic phenotype
High incidence
Short-term study: early time of onset (4 wk from surgery)
To study therapies
Need for technical expertise
Need for specific equipment
Surgical risks
Rapid progression compared to human
Anterior cruciate ligament transection (ACLT)7,39,40,61,48,67,70,87,126Model of posttraumatic phenotype
High incidence
Short-term study: early time of onset (3-10 wk from surgery)
Reproducible
To study therapies
Need for technical expertise
Need for specific equipment
Surgical risks
Rapid progression compared to human
Destabilization of medial meniscus (DMM)7,32,39,40Model of post traumatic phenotype
High incidence
Short-term study: early time of onset (4 wk from surgery)
To study therapies
The most frequently used method
Need for technical expertise
Need for specific equipment
Surgical risks
Rapid progression compared to human
Open in a separate windowSince all animal models have strengths and weaknesses, it is often best to plan using a number of models and techniques together to combine the results.In humans, the lack of correlation between OA imaging assessment and clinical signs highlights the need to consider the functional data and the quality of life to personalize OA management. Clinical outcomes are needed to achieve 2 main goals: to assess the impact of the OA in terms of pain and function and to study the efficacy of treatments.65 Recent reviews offer few practical approaches to mouse functional assessment and novel approaches to OA models in mice.7,32,67,75,79,83,87, 100,120 This review will focus on static and dynamic clinical assessment of OA using automatic and noninvasive emerging techniques (Test nameTechniquesKind of assessmentOutputSpecific equipment requiredStatic measurementVon Frey filament testingCalibrated nylon filaments of various thickness (and applied force) are pressed against the skin of the plantar surface of the paw in ascending order of forceStimulus- evoked pain-like behavior
Mechanical stimuli - Tactile allodynia
The most commonly used testLatency to paw withdrawal
and
Force exerted are recordedYesKnee extension testApply a knee extension on both the intact and affected knee
or
Passive extension range of the operated knee joint under anesthesiaStimulus-evoked pain-like behaviorNumber of vocalizations evoked in 5 extensionsNoneHotplateMouse placed on hotplate. A cutoff latency has been determined to avoid lesionsStimulus-evoked pain-like behavior
Heat stimuli- thermal sensitivityLatency of paw withdrawalYesRighting abilityMouse placed on its backNeuromuscular screeningLatency to regain its footingNoneCotton swab testBringing a cotton swab into contact with eyelashes, pinna, and whiskersStimulus-evoked pain-like behavior
Neuromuscular screeningWithdrawal or twitching responseNoneSpontaneous activitySpontaneous cage activityOne by one the cages must be laid out in a specific platformSpontaneous pain behavior
Nonstimulus evoked pain
ActivityVibrations evoked by animal movementsYesOpen field analysisExperiment is performed in a clear chamber and mice can freely exploreSpontaneous pain behavior
Nonstimulus evoked pain
Locomotor analysisPaw print assessment
Distance traveled, average walking speed, rest time, rearingYesGait analysisMouse is placed in a specific cage equipped with a fluorescent tube and a glass plate allowing an automated quantitative gait analysisNonstimulus evoked pain
Gait analysis
Indirect nociceptionIntensity of the paw contact area, velocity, stride frequency, length, symmetry, step widthYesDynamic weight bearing systemMouse placed is a specific cage. This method is a computerized capacitance meter (similar to gait analysis)Nonstimulus evoked pain
Weight-bearing deficits
Indirect nociceptionBody weight redistribution to a portion of the paw surfaceYesVoluntary wheel runningMouse placed is a specific cage with free access to stainless steel activity wheels. The wheel is connected to a computer that automatically record dataNonstimulus evoked pain
ActivityDistance traveled in the wheelYesBurrowing analysisMouse placed is a specific cage equipped with steel tubes (32 cm in length and 10 cm in diameter) and quartz sand in Plexiglas cages (600 · 340x200 mm)Nonstimulus evoked pain
ActivityAmount of sand burrowedYesDigital video recordingsMouse placed is a specific cage according to the toolNonstimulus evoked pain
Or
Evoked painScale of pain or specific outcomeYesDigital ventilated cage systemNondisrupting capacitive-based technique: records spontaneous activity 24/7, during both light and dark phases directly from the home cage rackSpontaneous pain behavior
Nonstimulus evoked pain
Activity-behaviorDistance walked, average speed, occupation front, occupation rear, activation density.
Animal locomotion index, animal tracking distance, animal tracking speed, animal running wheel distance and speed or rotationYesChallenged activityRotarod testGradual and continued acceleration of a rotating rod onto which mice are placedMotor coordination
Indirect nociceptionRotarod latency: riding time and speed with a maximum cut off.YesHind limb and fore grip strengthMouse placed over a base plate in front of a connected grasping toolMuscle strength of limbsPeak force, time resistanceYesWire hang analysisSuspension of the mouse on the wire and start the timeMuscle strength of limbs: muscle function and coordinationLatency to fall grippingNone
(self -constructed)
Open in a separate windowPain cannot be directly measured in rodents, so methods have been developed to quantify “pain-like” behaviors. The clinical assessment of mice should be tested both before and after the intervention (induced-OA ± administration of treatment) to take into account the habituation and establish a baseline to compare against.  相似文献   

10.
Ion channel regulation by protein S-acylation     
Michael J. Shipston 《The Journal of general physiology》2014,143(6):659-678
Protein S-acylation, the reversible covalent fatty-acid modification of cysteine residues, has emerged as a dynamic posttranslational modification (PTM) that controls the diversity, life cycle, and physiological function of numerous ligand- and voltage-gated ion channels. S-acylation is enzymatically mediated by a diverse family of acyltransferases (zDHHCs) and is reversed by acylthioesterases. However, for most ion channels, the dynamics and subcellular localization at which S-acylation and deacylation cycles occur are not known. S-acylation can control the two fundamental determinants of ion channel function: (1) the number of channels resident in a membrane and (2) the activity of the channel at the membrane. It controls the former by regulating channel trafficking and the latter by controlling channel kinetics and modulation by other PTMs. Ion channel function may be modulated by S-acylation of both pore-forming and regulatory subunits as well as through control of adapter, signaling, and scaffolding proteins in ion channel complexes. Importantly, cross-talk of S-acylation with other PTMs of both cysteine residues by themselves and neighboring sites of phosphorylation is an emerging concept in the control of ion channel physiology. In this review, I discuss the fundamentals of protein S-acylation and the tools available to investigate ion channel S-acylation. The mechanisms and role of S-acylation in controlling diverse stages of the ion channel life cycle and its effect on ion channel function are highlighted. Finally, I discuss future goals and challenges for the field to understand both the mechanistic basis for S-acylation control of ion channels and the functional consequence and implications for understanding the physiological function of ion channel S-acylation in health and disease.Ion channels are modified by the attachment to the channel protein of a wide array of small signaling molecules. These include phosphate groups (phosphorylation), ubiquitin (ubiquitination), small ubiquitin-like modifier (SUMO) proteins (SUMOylation), and various lipids (lipidation). Such PTMs are critical for controlling the physiological function of ion channels through regulation of the number of ion channels resident in the (plasma) membrane; their activity, kinetics, and modulation by other PTMs; or their interaction with other proteins. S-acylation is one of a group of covalent lipid modifications (Resh, 2013). However, unlike N-myristoylation and prenylation (which includes farnesylation and geranylgeranylation), S-acylation is reversible (Fig. 1). Because of the labile thioester bond, S-acylation thus represents a dynamic lipid modification to spatiotemporally control protein function. The most common form of S-acylation, the attachment of the C16 lipid palmitate to proteins (referred to as S-palmitoylation), was first described more than 30 years ago in the transmembrane glycoprotein of the vesicular stomatitis virus and various mammalian membrane proteins (Schmidt and Schlesinger, 1979; Schlesinger et al., 1980). A decade later, S-acylated ion channels—rodent voltage-gated sodium channels (Schmidt and Catterall, 1987) and the M2 ion channel from the influenza virus (Sugrue et al., 1990)—were first characterized. Since then, more than 50 distinct ion channel subunits have been experimentally demonstrated to be S-acylated (El-Husseini and Bredt, 2002; Linder and Deschenes, 2007; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Resh, 2012). In the last few years, with the cloning of enzymes controlling S-acylation and development of various proteomic tools, we have begun to gain substantial mechanistic and physiological insight into how S-acylation may control multiple facets of the life cycle of ion channels: from their assembly, through their trafficking and regulation at the plasma membrane, to their final degradation (Fig. 2).Open in a separate windowFigure 1.Protein S-acylation: a reversible lipid posttranslational modification of proteins. (A) Major lipid modifications of proteins. S-acylation is reversible due to the labile thioester bond between the lipid (typically, but not exclusively, palmitate) and the cysteine amino acid of is target protein. Other lipid modifications result from stable bond formation between either the N-terminal amino acid (amide) or the amino acid side chain in the protein (thioether and oxyester). The zDHHC family of palmitoyl acyltransferases mediates S-acylation with other enzyme families controlling other lipid modifications: N-methyltransferase (NMT) controls myristoylation of many proteins such as the src family kinase, Fyn kinase; and amide-linked palmitoylation of the secreted sonic hedgehog protein is mediated by Hedgehog acyltransferase (Hhat), a membrane-bound O-acyl transferase (MBOAT) family. Prenyl transferases catalyze farnesyl (farnesyltransferase, FTase) or geranylgeranyl (geranylgeranyl transferase I [GGTase I] and geranylgeranyl transferase II [GGTase II]) in small GTPase proteins such as RAS and the Rab proteins, respectively. Porcupine (Porcn) is a member of the MBOAT family acylates secreted proteins such as Wnt. (B) zDHHC enzymes typically use coenzyme A (CoA)-palmitate; however, other long chain fatty acids (either saturated or desaturated) can also be used. Deacylation is mediated by several acylthioesterases of the serine hydrolase family. (C) zDHHC acyltransferases (23 in humans) are predicted transmembrane proteins (typically with 4 or 6 transmembrane domains) with the catalytic DHHC domain located in a cytosolic loop.

Table 1.

Pore-forming subunits of ion channels experimentally determined to be S-acylated
ChannelSubunitGeneCandidate S-acylation sitesUniProt IDReferences
Ligand-gated
AMPAGluA1Gria1593FSLGAFMQQGCDISPRSLSGRIP23818Hayashi et al., 2005
819LAMLVALIEFCYKSRSESKRMKP23818Hayashi et al., 2005
GluA2Gria2600FSLGAFMRQGCDISPRSLSGRIP23819Hayashi et al., 2005
826LAMLVALIEFCYKSRAEAKRMKP23819Hayashi et al., 2005
GluA3Gria3605FSLGAFMQQGCDISPRSLSGRIQ9Z2W9Hayashi et al., 2005
831LAMMVALIEFCYKSRAESKRMKQ9Z2W9Hayashi et al., 2005
GluA4Gria4601FSLGAFMQQGCDISPRSLSGRIQ9Z2W8Hayashi et al., 2005
827LAMLVALIEFCYKSRAEAKRMKQ9Z2W8Hayashi et al., 2005
GABAAγ2Gabrg2405QERDEEYGYECLDGKDCASFFCCFEDCRTGAWRHGRIP22723Rathenberg et al., 2004; Fang et al., 2006
KainateGluK2Grik2848KNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVP39087Pickering et al., 1995
nAChRα4Chrna4263TVLVFYLPSECGEKVTLCISVO70174Alexander et al., 2010; Amici et al., 2012
α7Chrna7NDAlexander et al., 2010; Drisdel et al., 2004
β2Chrnb2NDAlexander et al., 2010
NMDAGluN2AGrin2a838EHLFYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKP35436Hayashi et al., 2009
1204SDRYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDP35436Hayashi et al., 2009
GluN2BGrin2b839EHLFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQQ01097Hayashi et al., 2009
1205DWEDRSGGNFCRSCPSKLHNYSSTVAGQNSGRQACIRCEACKKAGNLYDISQ01097Hayashi et al., 2009
P2X7P2X7P2rx7361AFCRSGVYPYCKCCEPCTVNEYYYRKKQ9Z1M0Gonnord et al., 2009
469APKSGDSPSWCQCGNCLPSRLPEQRRQ9Z1M0Gonnord et al., 2009
488PEQRRALEELCCRRKPGRCITTQ9Z1M0Gonnord et al., 2009
562DMADFAILPSCCRWRIRKEFPKQ9Z1M0Gonnord et al., 2009
Voltage gated
Potassium
BK, maxiKKCa1.1Kcnma143WRTLKYLWTVCCHCGGKTKEAQKIQ08460Jeffries et al., 2010
635MSIYKRMRRACCFDCGRSERDCSCMQ08460Tian et al., 2008; 2010
Kv1.1Kcna1233SFELVVRFFACPSKTDFFKNIP16388Gubitosi-Klug et al., 2005
Kv1.5Kcna516LRGGGEAGASCVQSPRGECGCQ61762Jindal et al., 2008
583VDLRRSLYALCLDTSRETDL-stopQ61762Zhang et al., 2007; Jindal et al., 2008
SodiumNaV1.2Scn2a1NDSchmidt and Catterall, 1987
640MNGKMHSAVDCNGVVSLVGGPP04775Bosmans et al., 2011
1042LEDLNNKKDSCISNHTTIEIGP04775Bosmans et al., 2011
1172TEDCVRKFKCCQISIEEGKGKP04775Bosmans et al., 2011
Other channels
AquaporinAQP4Aqp43DRAAARRWGKCGHSCSRESIMVAFKP55088Crane and Verkman, 2009; Suzuki et al., 2008
CFTRCFTRCFTR514EYRYRSVIKACQLEEDISKFAEKDP13569McClure et al., 2012
1385RRTLKQAFADCTVILCEHRIEAP13569McClure et al., 2012
ConnexinCx32Gjb1270GAGLAEKSDRCSAC-stopP28230Locke et al., 2006
ENaCENaC βScnn1b33TNTHGPKRIICEGPKKKAMWFLQ9WU38Mueller et al., 2010
547WITIIKLVASCKGLRRRRPQAPYQ9WU38Mueller et al., 2010
ENaC γScnn1g23PTIKDLMHWYCLNTNTHGCRRIVVSRGRLQ9WU39Mukherjee et al., 2014
Influenza M2M240LWILDRLFFKCIYRFFEHGLKQ20MD5Sugrue et al., 1990; Holsinger et al., 1995; Veit et al., 1991
RyR1RYR1Ryr114LRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLP11716Chaube et al., 2014
110RHAHSRMYLSCLTTSRSMTDKP11716Chaube et al., 2014
243RLVYYEGGAVCTHARSLWRLEP11716Chaube et al., 2014
295EDQGLVVVDACKAHTKATSFCP11716Chaube et al., 2014
527ASLIRGNRANCALFSTNLDWVP11716Chaube et al., 2014
1030ATKRSNRDSLCQAVRTLLGYGP11716Chaube et al., 2014
1664SHTLRLYRAVCALGNNRVAHAP11716Chaube et al., 2014
2011HFKDEADEEDCPLPEDIRQDLP11716Chaube et al., 2014
2227KMVTSCCRFLCYFCRISRQNQP11716Chaube et al., 2014
2316KGYPDIGWNPCGGERYLDFLRP11716Chaube et al., 2014
2353VVRLLIRKPECFGPALRGEGGP11716Chaube et al., 2014
2545EMALALNRYLCLAVLPLITKCAPLFAGTEHRP11716Chaube et al., 2014
3160DVQVSCYRTLCSIYSLGTTKNTYVEKLRPALGECLARLAAAMPVP11716Chaube et al., 2014
3392LLVRDEFSVLCRDLYALYPLLP11716Chaube et al., 2014
3625SKQRRRAVVACFRMTPLYNLPP11716Chaube et al., 2014
Open in a separate windowCommon channel abbreviation and subunit as well as gene names are given. Candidate S-acylation sites: experimentally determined cysteine residues (bold) with flanking 10 amino acids. Underlines indicate predicted transmembrane domains. Amino acid numbering corresponds to the UniProt ID. References: selected original supporting citations.Open in a separate windowFigure 2.Protein S-acylation and regulation of the ion channel lifecycle zDHHCs are found in multiple membrane compartments and regulate multiple steps in the ion channel lifecycle including: (1) assembly and (2) ER exit; (3) maturation and Golgi exit; (4) sorting and trafficking; (5) trafficking and insertion into target membrane; (6) clustering and localization in membrane microdomains; control of properties, activity (7), and regulation by other signaling pathways; and (8) internalization, recycling, and final degradation.

Table 3.

Other channels identified in mammalian palmitoylome screens
ChannelGene
Anion
Chloride channel 6Clcn6
Chloride intracellular channel 1Clic1
Chloride intracellular channel 4Clic4
Tweety homologue 1Ttyh1
Tweety homologue 3Ttyh3
Voltage-dependent anion channel 1Vdac1
Voltage-dependent anion channel 2Vdac2
Voltage-dependent anion channel 3Vdac3
Calcium
Voltage-dependent, L-type subunit α 1SCacna1s
Voltage-dependent, gamma subunit 8Cacng8
Cation
Amiloride-sensitive cation channel 2Accn2
Glutamate
Ionotropic, Δ1Grid1
Perforin
Perforin 1Prf1
Potassium
Voltage-gated channel, subfamily Q, member 2Kcnq2
Sodium
Voltage-gated, type I, αScn1a
Voltage-gated, type III, αScn3a
Voltage-gated, type IX, αScn9a
Transient receptor potential
Cation channel, subfamily V, member 2Trpv2
Cation channel, subfamily M, member 7Trpm7
Open in a separate windowChannels identified in global S-acylation screens (Wan et al., 2007, 2013; Kang et al., 2008; Martin and Cravatt, 2009; Yang et al., 2010; Yount et al., 2010; Merrick et al., 2011; Wilson et al., 2011; Jones et al., 2012; Ren et al., 2013; Chaube et al., 2014) and not independently characterized as in and2.2. Common channel abbreviation and gene names are given.Here, I provide a primer on the fundamentals of S-acylation, in the context of ion channel regulation, along with a brief overview of tools available to interrogate ion channel S-acylation. I will discuss key examples of how S-acylation controls distinct stages of the ion channel life cycle before highlighting some of the key challenges for the field in the future.

Fundamentals of S-acylation: The what, when, where, and how

S-acylation: A fatty modification that controls multiple aspects of protein function.

Protein S-acylation results from the attachment of a fatty acid to intracellular cysteine residues of proteins via a labile, thioester linkage (Fig. 1, A and B). Because the thioester bond is subject to nucleophilic attack, S-acylation, unlike other lipid modifications such as N-myristoylation and prenylation, is reversible. However, for most ion channels, as for other S-acylated proteins, the dynamics of S-acylation are poorly understood. Distinct classes of proteins can undergo cycles of acylation and deacylation that are very rapid (e.g., on the timescale of seconds, as exemplified by rat sarcoma [RAS] proteins), much longer (hours), or essentially irreversible during the lifespan of the protein (El-Husseini and Bredt, 2002; Linder and Deschenes, 2007; Zeidman et al., 2009; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Resh, 2012). For most ion channels, in fact most S-acylated proteins, the identity of the native lipid species attached to specific cysteine residues is also largely unknown. However, the saturated C16:0 lipid palmitate is commonly thought to be the major lipid species in many S-acylated proteins (Fig. 1). Indeed, much of the earliest work on S-acylation involved the metabolic labeling of proteins in cells with tritiated [3H]palmitate, an approach that still remains useful and important. However, lipids with different chain lengths and degrees of unsaturation (such as oleic and stearic acids) can also be added to cysteines via a thioester linkage, potentially allowing differential control of protein properties through the attachment of distinct fatty acids (El-Husseini and Bredt, 2002; Linder and Deschenes, 2007; Zeidman et al., 2009; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Resh, 2012).S-acylation increases protein hydrophobicity and has thus been implicated in controlling protein function in many different ways. Most commonly, as with membrane-associated proteins like RAS and postsynaptic density protein 95 (PSD-95), S-acylation controls membrane attachment and intracellular trafficking. However, S-acylation can also control protein–protein interactions, protein targeting to membrane subdomains, protein stability, and regulation by other PTMs such as phosphorylation (El-Husseini and Bredt, 2002; Fukata and Fukata, 2010; Linder and Deschenes, 2007; Greaves and Chamberlain, 2011; Shipston, 2011; Resh, 2012). Evidence for all these mechanisms in controlling ion channel function is beginning to emerge.

Enzymatic control of S-acylation by zinc finger–containing acyltransferase (zDHHC) transmembrane acyltransferases.

Although autoacylation of some proteins has been reported in the presence of acyl coenzyme A (acyl-CoA; Linder and Deschenes, 2007), most cellular S-acylation, in organisms from yeast to humans, is thought to be enzymatically driven by a family of protein acyltransferases (gene family: zDHHC, with ∼23 members in mammals). These acyltransferases are predicted to be transmembrane zinc finger containing proteins (Fig. 1 C) that include a conserved Asp-His-His-Cys (DHHC) signature sequence within a cysteine-rich stretch of ∼50 amino acids critical for catalytic activity (Fukata et al., 2004). Although the enzymatic activity and lipid specificity of all of the zDHHC family proteins has not been elucidated, S-acylation is thought to proceed through a common, two step “ping pong” process (Mitchell et al., 2010; Jennings and Linder, 2012). However, different zDHHC enzymes may show different acyl-CoA substrate specificities. For example, zDHHC3 activity is reduced by acyl chains of >16 carbons (e.g., stearoyl CoA), whereas zDHHC2 efficiently transfers acyl chains of 14 carbons or longer (Jennings and Linder, 2012). The local availability of different acyl-CoA species may thus play an important role in differentially controlling protein S-acylation.We know very little about how zDHHC activity and function are regulated. Dimerization of zDHHCs 2 and 3 reduces their zDHHC activity compared with the monomeric form (Lai and Linder, 2013). Moreover, zDHHCs undergo autoacylation and contain predicted sites for other posttranslational modifications. Almost half of all mammalian zDHHCs contain a C-terminal PSD-95, Discs large, and ZO-1 (PDZ) domain binding motif, allowing them to assemble with various PDZ domain proteins that regulate ion channels (such as GRIP1b and PSD-95; Thomas and Hayashi, 2013). Other protein interaction domains are also observed in zDHHCs, such as ankyrin repeats in zDHHC17 and zDHHC13 (Greaves and Chamberlain, 2011). Indeed, increasing evidence suggests that various ion channels—including the ligand-gated γ-aminobutyric (GABAA), α-amino-3-hydroxyl-5-methyl-4-isoxazole-propionate (AMPA), and NMDA receptors and the large conductance calcium- and voltage-activated (BK) potassium channels—can assemble in complexes with their cognate zDHHCs.The expansion of the number of zDHHCs in mammals (23 vs. 7 in yeast), together with increased prevalence of PDZ interaction motifs, likely represents evolutionary gain-of-function mechanisms to diversify zDHHC function (Thomas and Hayashi, 2013). Evolutionary gain of function is also seen in ion channel subunit orthologues through acquisition of S-acylated cysteine residues absent in orthologues lower in the phylogenetic tree (such as the transmembrane domain 4 [TM4] sites in GluA1–4 subunits of AMPA receptors [Thomas and Hayashi, 2013] and the sites in the alternatively spliced stress-regulated exon [STREX] insert in the C terminus of the BK channel [Tian et al., 2008]). Importantly, some zDHHCs may have additional roles beyond their acyltransferase function. For example, the Drosophila melanogaster zDHHC23 orthologue lacks the catalytic DHHC sequence, and thus protein acyltransferase activity, and is a chaperone involved in protein trafficking (Johswich et al., 2009), whereas mammalian zDHHC 23 has a functional zDHHC motif and, in addition to S-acylating BK channels (Tian et al., 2012), can bind and regulate, but does not S-acylate, neuronal nitric oxide synthase (nNOS; Saitoh et al., 2004).However, as with most S-acylated proteins, the identity of the zDHHCs that modify specific cysteine residues on individual ion channels is not known. Indeed, relatively few studies have tried to systematically identify the zDHHCs controlling ion channel function (Tian et al., 2010, 2012). Thus we are largely ignorant of the extent to which different zDHHCs may have specific ion channel targets or may display specificity. Some details are beginning to emerge: for example, zDHHC3 appears to be a rather promiscuous acyltransferase reported to S-acylate several ion channels (Keller et al., 2004; Hayashi et al., 2005, 2009; Tian et al., 2010), whereas distinct sites on the same ion channel subunit can be modified by distinct subsets of zDHHCs (Tian et al., 2010, 2012). Although we are still in the foothills of understanding the substrates and physiological roles of different zDHHCs, mutation or loss of function in zDHHCs is associated with an increasing number of human disorders, including cancers, various neurological disorders (such as Huntington’s disease and X-linked mental retardations), and disruption of endocrine function in diabetes (Linder and Deschenes, 2007; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Resh, 2012).

Deacylation is controlled by acylthioesterases.

Protein deacylation is enzymatically driven by a family of acylthioesterases that belong to the serine hydrolase superfamily (Zeidman et al., 2009; Bachovchin et al., 2010). Indeed, using a broad spectrum serine lipase inhibitor, global proteomic S-acylation profiling identified a subset of serine hydrolases responsible for depalmitoylation (Martin et al., 2012). This study identified both the previously known acylthioesterases as well as potential novel candidate acylthioesterases. The acylthioesterases responsible for deacylating ion channels, as for most other acylated membrane proteins, have not been clearly defined. Furthermore, the extent to which different members of the serine hydrolase superfamily display acylthioesterase activity toward ion channels is not known. Moreover, whether additional mechanisms of nucleophilic attack of the labile thioester bond may also mediate deacylation is not known.Homeostatic control of deacylation of many signaling proteins is likely affected by a family of cytosolic acyl protein thioesterases including lysophospholipase 1 (LYPLA1; Yeh et al., 1999; Devedjiev et al., 2000) and lysophospholipase 2 (LYPLA2; Tomatis et al., 2010). These enzymes show some selectivity for different S-acylated peptides (Tomatis et al., 2010). Indeed, LYPLA1, but not LYPLA2, deacylates the S0-S1 loop of BK channels, leading to Golgi retention of the channel (Tian et al., 2012). A splice variant of the related LYPLAL1 acylthioesterases can also deacylate the BK channel S0-S1 loop, although the crystal structure of LYPLAL1 suggests it is likely to have a preference for lipids with shorter chains than palmitate (Bürger et al., 2012). Thus, whether lipid preference depends on protein interactions or if BK channels have multiple lipid species at the multicysteine S0-S1 site remain unknown. Relatively little is known about the regulation of these acylthioesterases; however, both LYPLA1 and LYPLA2 are themselves S-acylated. This controls their trafficking and association with membranes (Kong et al., 2013; Vartak et al., 2014) and may be important for accessing the thioesterase bond at the membrane interface. Additional mechanisms may promote accessibility of thioesterases to target cysteines. For example, the prolyl isomerase protein FKBP12 binds to palmitoylated RAS, and promotes RAS deacylation via a proline residue near the S-acylated cysteine (Ahearn et al., 2011).Upon lysosomal degradation, many proteins are deacylated by the lysosomal palmitoyl protein thioesterase (PPT1; Verkruyse and Hofmann, 1996), and mutations in PPT1 lead to the devastating condition of infantile neuronal ceroid lipofuscinosis (Vesa et al., 1995; Sarkar et al., 2013). However, PPT1 can also be found in synaptic and other transport vesicles, and genetic deletion of PPT1 in mice may have different effects on similar proteins, which suggests roles beyond just lysosomal mediated degradation. For example, in PPT1 knockout mice the total expression and surface membrane abundance of the GluA4 AMPA receptor subunit was decreased, whereas PPT1 knockout had no effect on GluA1 or GluA2 AMPA subunits nor on NMDA receptor subunit expression or surface abundance (Finn et al., 2012).However, for most ion channels, the questions of which enzymes control deacylation, where this occurs in cells, and how the time course of acylation–deacylation cycles are regulated are largely unknown. Thus, whether deacylation plays an active role in channel regulation remains poorly understood.

S-acylation occurs at membrane interfaces.

Because the zDHHCs are transmembrane proteins and the catalytic DHHC domain is located at the cytosolic interface with membranes (Fig. 1 C), S-acylation of ion channels occurs at membrane interfaces. Although overexpression studies of recombinant mammalian zDHHCs in heterologous expression systems have indicated that most zDHHCs are localized to either the endoplasmic reticular or Golgi apparatus membranes (or both; Ohno et al., 2006), some zDHHCs are also found in other compartments, including the plasma membrane and trafficking endosomes (Thomas et al., 2012; Fukata et al., 2013). We know very little about the regulation and subcellular localization of most native zDHHC enzymes in different cell types, in large part because of the lack of high-quality antibodies that recognize native zDHHCs. However, some enzymes, including zDHHC2, can dynamically shuttle between different membrane compartments. Activity-dependent redistribution of zDHHC2 in neurons (Noritake et al., 2009) controls S-acylation of the postsynaptic scaffolding protein PSD-95, thereby regulating NMDA receptor function. Intriguingly, as ion channels themselves determine cellular excitability, this may provide a local feedback mechanism to regulate S-acylation status. Thus, although different zDHHCs may reside in multiple membrane compartments through which ion channels traffic, the subcellular location at which most ion channels are S-acylated, as well as the temporal dynamics, is largely unknown. As discussed below (see the “Tools to analyze ion channel S-acylation” section), we are starting to unravel some of the details, with ER exit, Golgi retention, recycling endosomes, and local plasma membrane compartments being key sites in the control of ion channel S-acylation (Fig. 2).

Local membrane and protein environment determines cysteine S-acylation.

The efficiency of S-acylation of cysteine residues is likely enhanced by its localization at membranes because the local concentration of fatty acyl CoA is increased near hydrophobic environments (Bélanger et al., 2001). Furthermore, S-acylation of polytopic transmembrane proteins such as ion channels would be facilitated when S-acylated cysteines are bought into close proximity of membranes by membrane targeting mechanisms such as transmembrane helices (Figs. 3 and and4).4). However, the S-acylated cysteine is located within 10 amino acids of a transmembrane domain in only ∼20% of identified S-acylated ion channel subunits, such as the TM4 site of GluA1–4 (and2).2). Most S-acylated cysteines are located either within intracellular loops (∼40%: Fig. 3, A and B) or the N- or C-terminal cytosolic domains (∼5% and 35%, respectively; Fig. 3, A and B). Furthermore, the majority of S-acylated cysteines located in intracellular loops or intracellular N- or C-terminal domains of ion channel subunits are within predicted regions of protein disorder (Fig. 3 B). This suggests that S-acylation may provide a signal to promote conformational restraints on such domains, in particular by providing a membrane anchor. For these sites, additional initiating membrane association signals are likely required adjacent to the site of S-acylation. Likely candidates include other hydrophobic domains (as for the TM2 site in GluA1–4 subunits; Fig. 4 A) and other lipid anchors (e.g., myristoylation in src family kinases, such as Fyn kinase). However, in >30% of S-acylated ion channels, the S-acylated cysteine is juxtaposed to a (poly) basic region of amino acids that likely allows electrostatic interaction with negative membrane phospholipids. The BK channel pore-forming α subunit, encoded by the KCNMA1 gene, provides a clear example of this latter mechanism. This channel is S-acylated within an alternatively spliced domain (STREX) in its large intracellular C terminus (Fig. 4 C). Immediately upstream of the S-acylated dicysteine motif is a polybasic region enriched with arginine and lysine. Site-directed mutation of these basic amino acids disrupts S-acylation of the downstream cysteine residues (Jeffries et al., 2012). Furthermore, phosphorylation of a consensus PKA site (i.e., introduction of negatively charged phosphate) into the polybasic domain prevents STREX S-acylation. Thus, at the STREX domain, an electrostatic switch, controlled by phosphorylation, is an important determinant of BK channel S-acylation. In other proteins, cysteine reactivity is also enhanced by proximity to basic (or hydrophobic) residues (Bélanger et al., 2001; Britto et al., 2002; Kümmel et al., 2010). Furthermore, cysteine residues are subject to a range of modifications including nitrosylation, sulphydration, reduction-oxidation (REDOX) modification, and formation of disulphide bonds (Sen and Snyder, 2010). Evidence is beginning to emerge that these reversible modifications are mutually competitive for S-acylation of target cysteines (see the “S-acylation and posttranslational cross-talk controls channel trafficking and activity” section; Ho et al., 2011; Burgoyne et al., 2012).Open in a separate windowFigure 3.S-acylation sites in ion channel pore-forming subunits. (A) Schematic illustrating different locations of cysteine S-acylation in transmembrane ion channels subunits. (B) Relative proportion of identified S-acylated cysteine residues: in each location indicated in A (top); in -C-, -CC-, or -Cx(2–3)C- motifs (middle); or in cytosolic regions of predicted protein disorder (bottom; determined using multiple algorithms on the DisProt server, http://www.disprot.org/metapredictor.php; Sickmeier et al., 2007) for transmembrane ion channel pore-forming subunits.Open in a separate windowFigure 4.Multisite S-acylation in ion channels controls distinct functions. (A–C) Schematic illustrating location of multiple S-acylated domains in AMPA receptor GluA1–4 subunits (A), NMDA receptor GluN2A subunits (B), and BK channel pore-forming α subunits (C), encoded by the Kcnma1 gene. Each domain confers distinct functions/properties on the respective ion channel and is regulated by distinct zDHHCs (see the “Control of ion channel cell surface expression and spatial organization in membranes” section for further details).

Table 2.

Accessory subunits and selected ion channel adapter proteins
ChannelSubunitGeneCandidate S-acylation sitesUniProt IDReferences
Voltage gated
CalciumCaVβ2aCacnb21MQCCGLVHRRRVRVQ8CC27Chien et al., 1996; Stephens et al., 2000; Heneghan et al., 2009; Mitra-Ganguli et al., 2009
PotassiumKChip2Kcnip234LKQRFLKLLPCCGPQALPSVSEQ9JJ69Takimoto et al., 2002
KChip3Kcnip335PRFTRQALMRCCLIKWILSSAAQ9QXT8Takimoto et al., 2002
BK β4Kcnmb4193VGVLIVVLTICAKSLAVKAEAQ9JIN6Chen et al., 2013
Adapter proteins that interact with ion channelsPICK1Pick1404TGPTDKGGSWCDS-stopQ62083Thomas et al., 2013
Grip1bGrip11MPGWKKNIPICLQAEEQEREQ925T6-2Thomas et al., 2012; Yamazaki et al., 2001
psd-95Dlg41MDCLCIVTTKKYRQ62108Topinka and Bredt, 1998
S-delphilinGrid2ip1MSCLGIFIPKKHQ0QWG9-2Matsuda et al., 2006
Ankyrin-GAnk360YIKNGVDVNICNQNGLNALHLF1LNM3He et al., 2012
Open in a separate windowCommon channel abbreviation and subunit as well as gene names are given. Candidate S-acylation sites: experimentally determined cysteine residues (bold) with flanking 10 amino acids. Underlines indicate predicted transmembrane domains. Amino acid numbering corresponds to the UniProt ID. References: selected original supporting citations.Although these linear amino acid sequence features are likely to be important for efficient S-acylation, there is no canonical “consensus” S-acylation motif analogous to the linear amino acid sequences that predict sites of phosphorylation. Of the experimentally validated ion channel subunits shown to be S-acylated, ∼70% of candidate S-acylated cysteines are predominantly characterized as single cysteine (-C-) motifs, whereas dicysteine motifs (-CC-) and (CX(1–3)C-) motifs comprise ∼10% and 20% of all sites, respectively (Fig. 3 B). However, several freely available online predictive tools have proved successful in characterizing potential new palmitoylation targets. In particular, the latest iteration of the multiplatform CSS-palm 4.0 tool (Ren et al., 2008) exploits a Group-based prediction algorithm by comparing the surrounding amino acid sequence similarity to that of a set of 583 experimentally determined S-acylation sites from 277 distinct proteins. CSS-palm 4.0 predicts >80% of the experimentally identified ion channel S-acylation sites (Location of S-acylated cysteine is important for differential control of channel function.Many proteins are S-acylated at multiple sites. A remarkable example of this, in the ion channel field, is the recent identification of 18 S-acylated cysteine residues in the skeletal muscle ryanodine receptor/Ca2+-release channel (RyR1). The S-acylated cysteine residues are distributed throughout the cytosolic N terminus, including domains important for protein–protein interactions (Chaube et al., 2014). Although deacylation of skeletal muscle RyR1 reduces RyR1 activity, the question of which of these cysteine residues in RyR1 are important for this effect and whether distinct S-acylated cysteines in RyR1 control different functions and/or properties remains to be determined.However, both ligand-gated (NMDA and AMPA) and voltage-gated (BK) channels provide remarkable insights into how S-acylation of different domains within the same polytopic protein can exert fundamentally distinct effects (Fig. 4). For example, S-acylation of the hydrophobic cytosolic TM2 domain located at the membrane interface of the AMPA GluA1 subunit (Fig. 4 A) decreases AMPA receptor surface expression by retaining the subunit at the Golgi apparatus (Hayashi et al., 2005). In contrast, depalmitoylation of the C-terminal cysteine in GluA1 results in enhanced PKC-dependent phosphorylation of neighboring serine residues, which results in increased interaction with the actin-binding protein 4.1N in neurons, leading to enhanced AMPA plasma membrane insertion (Lin et al., 2009). S-acylation of the C-terminal cluster of cysteine residues (Fig. 4 B, Cys II site) in GluN2A and GluN2B controls Golgi retention, whereas palmitoylation of the cysteine cluster (Cys I site) proximal to the M4 transmembrane domain controls channel internalization (Hayashi et al., 2009). Distinct roles of S-acylation on channel trafficking and regulation are also observed in BK channels (Figs. 4 C and and5).5). S-acylation of the N-terminal intracellular S0-S1 linker controls surface expression, in part by controlling ER and Golgi exit of the channel (Jeffries et al., 2010; Tian et al., 2012), whereas S-acylation of the large intracellular C terminus, within the alternatively spliced STREX domain, controls BK channel regulation by AGC family protein kinases (Tian et al., 2008; Zhou et al., 2012).Open in a separate windowFigure 5.S-acylation controls BK channel trafficking and regulation by AGC family protein kinases via distinct sites. The BK channel STREX splice variant pore-forming α subunit is S-acylated at two sites: the S0-S1 loop and the STREX domain in the large intracellular C terminus. S-acylation of the S0-S1 loop promotes high surface membrane expression of the channel; thus, deacylation of this site decreases the number of channels at the cell surface (see the “Control of ion channel cell surface expression and spatial organization in membranes” section for further details). In contrast, S-acylation of the STREX domain allows inhibition of channel activity by PKA-mediated phosphorylation of a PKA serine motif (closed hexagon) immediately upstream of the palmitoylated cysteine residues in STREX. In the S-acylated state, PKC has no effect on channel activity even though a PKC phosphorylation site serine motif is located immediately downstream of the STREX domain (open triangle). Deacylation of STREX dissociates the STREX domain from the plasma membrane, and exposes the PKC serine motif so that it can now be phosphorylated by PKC (closed triangle), resulting in channel inhibition. In the deacylated state, PKA has no effect on channel activity (open hexagon). Thus, deacylation of the STREX domain switches channel regulation from a PKA-inhibited to a PKC-inhibited phenotype (see the “S-acylation and posttranslational cross-talk controls channel trafficking and activity” section for further details).How does S-acylation of distinct domains control such behavior, and are distinct sites on the same protein acylated by distinct zDHHCs? A systematic small interfering RNA (siRNA) screen of zDHHC enzymes mediating BK channel S-acylation indicated that distinct subsets of zDHHCs modify discrete sites. The S0-S1 loop is S-acylated by zDHHCs 22 and 23, whereas the STREX domain is S-acylated by several zDHHCs including 3, 9, and 17 (Tian et al., 2008, 2012). In both cases, each domain has two distinct S-acylated cysteines; however, whether these cysteines are differentially S-acylated by specific zDHHCs is unknown, Furthermore, whether multiple zDHHCs are required because the domains undergo repeated cycles of S-acylation and deacylation, and thus different zDHHCs function at different stages of the protein lifecycle, remains to be determined. Although systematic siRNA screens have, to date, not been performed on other ion channels, data from other multiply S-acylated channels, such as NMDA, AMPA, and BK channel subunits, supports the hypothesis that zDHHCs can show substrate specificity (Hayashi et al., 2005, 2009; Tian et al., 2010).It is generally assumed that S-acylation facilitates the membrane association of protein domains. This is clearly the case for peripheral membrane proteins, such as RAS or PSD-95, but direct experimental evidence for S-acylation controlling membrane association of the cytosolic domains of transmembrane proteins is largely elusive. One of the best examples involves the large C-terminal domain of the BK channel, which comprises more than two-thirds of the pore-forming subunit (Fig. 5). In the absence of S-acylation of the STREX domain, or exclusion of the 59–amino acid STREX insert, the BK channel C terminus is cytosolic (Tian et al., 2008). However, if the STREX domain is S-acylated, the entire C terminus associates with the plasma membrane, a process that can be dynamically regulated by phosphorylation of a serine immediately upstream of the S-acylated cysteines in the STREX domain (Tian et al., 2008). This S-acylation–dependent membrane association markedly affects the properties and regulation of the channel (Jeffries et al., 2012) and has been proposed to confer significant structural rearrangements. In support of such structural rearrangement, S-acylated STREX channels are not inhibited by PKC-dependent phosphorylation even though a PKC phosphorylation site serine motif, conserved in other BK channel variants, is present downstream of the STREX domain. In other BK channel variants lacking the STREX insert, this PKC site is required for channel inhibition by PKC-dependent phosphorylation. However, after deacylation of the STREX domain, PKC can now phosphorylate this PKC phosphorylation serine motif, which suggests that the site has become accessible, consequently resulting in channel inhibition (Fig. 5; Zhou et al., 2012).How might S-acylation of a cysteine residue juxtaposed to another membrane anchoring domain control protein function? The simplest mechanism would involve acting as an additional anchor (Fig. 3 A). In some systems, juxta-transmembrane palmitoylation allows tilting of transmembrane domains, effectively shortening the transmembrane domain to reduce hydrophobic mismatch (Nyholm et al., 2007), particularly at the thinner ER membrane (Abrami et al., 2008; Charollais and Van Der Goot, 2009; Baekkeskov and Kanaani, 2009), and confer conformational restraints on the peptide (Fig. 3 A). Such a mechanism has been proposed to control ER exit of the regulatory β4 subunits of BK channels. In this case, depalmitoylation of a cysteine residue juxtaposed to the second transmembrane domain of the β4 subunits may result in hydrophobic mismatch at the ER, reducing ER exit, and yield a conformation that is unfavorable for interaction with BK channel α subunits, thereby decreasing surface expression of BK channel α subunits (Chen et al., 2013).

Tools to analyze ion channel S-acylation

Before the seminal discovery of the mammalian enzymes that control S-acylation (Fukata et al., 2004) and current advances in proteomic techniques to assay S-acylation, progress in the field was relatively slow, largely because of the lack of pharmacological, proteomic, and genetic tools to investigate the functional role of S-acylation. It is perhaps instructive to consider that protein tyrosine phosphorylation was discovered the same year as S-acylation (Hunter, 2009). However, the subsequent rapid identification and cloning of tyrosine kinases provided a very extensive toolkit to investigate this pathway. Although the S-acylation toolkit remains limited, the last few years have seen rapid progress in our ability to interrogate S-acylation function and its control of ion channel physiology. Furthermore, S-acylation prediction algorithms, such as CSS-palm 4.0 (Ren et al., 2008), provide an in silico platform to inform experimental approaches for candidate targets.

Pharmacological tools.

The S-acylation pharmacological toolkit remains, unfortunately, empty, with limited specific agents with which to explore S-acylation function in vitro or in vivo. Although the palmitate analogue 2-bromopalmitate (2-BP) is widely used for cellular assays and to analyze ion channel regulation by S-acylation, caution must be taken in using this agent, even though it remains our best pharmacological inhibitor of zDHHCs (Resh, 2006; Davda et al., 2013; Zheng et al., 2013). Unfortunately, 2-BP is a nonselective inhibitor of lipid metabolism and many membrane-associated enzymes, and displays widespread promiscuity (e.g., Davda et al., 2013); does not show selectivity toward specific zDHHC proteins (Jennings et al., 2009); has many pleiotropic effects on cells at high concentrations, including cytotoxicity (Resh, 2006); and also inhibits acylthioesterases (Pedro et al., 2013). Other lipid inhibitors include cerulenin and tunicamycin. However, cerulenin affects many aspects of lipid metabolism, and tunicamycin inhibits N-linked glycosylation (Resh, 2006). Although some nonlipid inhibitors have been developed, these are not widely used (Ducker et al., 2006; Jennings et al., 2009), and there are currently no known activators of zDHHCs or compounds that inhibit specific zDHHCs. In the last few years, several inhibitors for the acylthioesterases LYPLA1 and LYPLA2 have been developed (Bachovchin et al., 2010; Dekker et al., 2010; Adibekian et al., 2012). However, several of these compounds, such as palmostatin B, are active against several members of the larger serine hydrolase family. Clearly, the development of novel S-acylation inhibitors and activators that display both specificity and zDHHC selectivity would represent a substantial advance for investigation of channel S-acylation.

Genetic tools.

To date, most studies have used overexpression of candidate zDHHCs in heterologous expression or native systems and analyzed increases in [3H]palmitate incorporation to define zDHHCs that may S-acylate specific ion channels (e.g. Rathenberg et al., 2004; Hayashi et al., 2005, 2009; Tian et al., 2010; Thomas et al., 2012). Although this is a powerful approach, caution is required to determine whether results obtained with overexpression in fact replicate endogenous regulation. For example, overexpression of some zDHHCs normally expressed in the cell type of interest can result in S-acylation of a cysteine residue that is not endogenously palmitoylated in BK channels (Tian et al., 2010). Point mutation of the cysteine of the catalytic DHHC domain abolishes the acyltransferase activity of zDHHCs and is thus an invaluable approach to confirming that the acyltransferase function of overexpressed zDHHC is required by itself. Increasingly, knockdown of endogenous zDHHCs using siRNA, and related approaches, is beginning to reveal the identity of zDHHCs that S-acylate native ion channel subunits. For example, knockdown of zDHHCs 5 or 8 reduces S-acylation of the accessory subunits PICK1 and Grip1, which control AMPA receptor trafficking (Thomas et al., 2012, 2013); and knockdown of zDHHC2 disrupts local nanoclusters of the PDZ domain protein PSD-95 in neuronal dendrites to control AMPA receptor membrane localization (Fukata et al., 2013). However, relatively few studies have taken a systematic knockdown approach to identify zDHHCs important for ion channel S-acylation. One such approach has, however, revealed that multiple, distinct zDHHCs mediate palmitoylation of the BK channel C terminus (zDHHCs 3, 5, 7, 9, and 17) and that a different subset of zDHHCs (22 and 23) mediate S-acylation of the intracellular S0-S1 loop in the same channel (Tian et al., 2010, 2012). Because some zDHHCs are themselves palmitoylated, the functional effect of overexpressing or knocking down individual zDHHCs on the localization and activity of other zDHHCs must also be carefully determined. For example, siRNA-mediated knockdown of zDHHC 5, 7, or 17 in HEK293 cells paradoxically results in an up-regulation of zDHHC23 mRNA expression (Tian et al., 2012). Furthermore, because many signaling and cytoskeletal elements are also controlled by S-acylation, direct effects on channel S-acylation by themselves must be evaluated in parallel (for example using site-directed cysteine mutants of the channel subunit). Fewer studies have used these approaches to examine the role of acylthioesterases, although overexpression of LYPLA1 and a splice variant of LYPLAL1, but not LYPLA2, deacylates the S0-S1 loop of the BK channel, promoting Golgi retention of the channels (Tian et al., 2012). Gene-trap and knockout mouse models for some zDHHCs (such as 5 and 17) are becoming available, although full phenotypic analysis and analysis of ion channel function in these models are largely lacking.

Proteomic and imaging tools. Lipid-centric (metabolic) labeling assays.

Metabolic labeling approaches are most suited to analysis of isolated cells, rather than tissues, but provide information on dynamic palmitoylation of proteins during the relatively short (∼4 h) labeling period as well as insight into the species of lipid bound to cysteine residues. The classical approach using radioactive palmitate (e.g., [3H]palmitate) remains a “gold standard” for validation, in particular for identification that palmitate is the bound lipid. However, metabolic labeling with [3H]palmitate generally requires immunoprecipitation and days to weeks of autoradiography or fluorography, particularly when analyzing low abundance membrane proteins such as ion channels. To overcome some of these issues, and also to provide a platform to allow cellular imaging of S-acylation, a variety of biorthogonal lipid probes have recently been developed (Hannoush and Arenas-Ramirez, 2009; Hannoush, 2012; Martin et al., 2012; for reviews see Charron et al., 2009a; Hannoush and Sun, 2010). These probes are modified fatty acids with reactive groups, such as an azide or alkyne group, allowing labeled proteins to be conjugated to biotin or fluorophores via the reactive group using Staudinger ligation or “click” chemistry. In particular, development of a family of ω-alkynyl fatty acid probes of different chain lengths (such as Alk-C16 and Alk-C18) have been exploited for proteomic profiling as well as single cell imaging (Gao and Hannoush, 2014) and have been used to identify candidate S-acylated channels in several mammalian cell lines (Charron et al., 2009b; Hannoush and Arenas-Ramirez, 2009; Martin and Cravatt, 2009; Yap et al., 2010; Yount et al., 2010; Martin et al., 2012). It is important to note that palmitic acid can also be incorporated into free N-terminal cysteines of proteins via an amide linkage (N-palmitoylation), addition of the monounsaturated palmitoleic acid via an oxyester linkage to a serine residue (O-palmitoylation), and oleic acid (oleoylation) as well as myristate via amide linkages on lysine residues (Stevenson et al., 1992; Linder and Deschenes, 2007; Hannoush and Sun, 2010; Schey et al., 2010). These modifications can be discriminated from S-acylation by their insensitivity to hydroxylamine cleavage (at neutral pH) compared with the S-acylation thioester linkage. Whether N- or O-linked palmitoylation or oleoylation controls ion channel function remains to be determined.

Cysteine centric (cysteine accessibility) assays: Acyl-biotin exchange (ABE) and resin-assisted capture (Acyl-RAC).

The metabolic labeling approach requires treating isolated cells with lipid conjugates and thus largely precludes analysis of native S-acylation in tissues. However, several related approaches have been developed that exploit the exposure of a reactive cysteine after hydroxylamine cleavage (at neutral pH) of the cysteine-acyl thioester linkage. The newly exposed cysteine thiol can then react with cysteine-reactive groups (such as biotin-BMCC or biotin-HPDP used in the ABE approach; Drisdel and Green, 2004; Drisdel et al., 2006; Draper and Smith, 2009; Wan et al., 2007) or thiopropyl sepharose (used in Acyl-RAC; Forrester et al., 2011) to allow purification of S-acylated proteins that can be identified by Western blot analysis or mass spectrometry. Acyl-RAC has been reported to improve detection of higher molecular weight S-acylated proteins and thus may prove valuable for ion channel analysis. These approaches have been exploited to determine the “palmitoylome” in several species and tissues (e.g., Wan et al., 2007, 2013; Kang et al., 2008; Martin and Cravatt, 2009; Yang et al., 2010; Yount et al., 2010; Merrick et al., 2011; Wilson et al., 2011; Jones et al., 2012; Ren et al., 2013). For example, analysis of rat brain homogenates identified both previously characterized as well as novel S-acylated ion channels (Wan et al., 2013), although it must be remembered that these approaches detect S-acylation and do not define S-palmitoylation per se. Cysteine accessibility approaches determine the net amount of preexisting S-acylated proteins; however, caution is required to eliminate false positives. In particular it is necessary to fully block all reactive cysteines before hydroxylamine cleavage; moreover, the identity of the endogenously bound lipid is of course not known.The lipid- and cysteine-centric approaches are thus complementary. In conjunction with site-directed mutagenesis of candidate S-acylated cysteine residues in ion channel subunits, these approaches have provided substantial insight into the role and regulation of ion channel S-acylation (Fukata et al., 2013). However, this approach does not directly confirm that the protein is S-acylated per se. Furthermore, in most ion channels, and in fact most S-acylated proteins, the identity of the native lipid bound to a specific S-acylated cysteine is not known. Although palmitate is considered to be the major lipid species involved in S-acylation, this has not been directly demonstrated in most cases, and other fatty acids, including arachidonic acid, oleate acid, and stearic acid, have also been reported to bind to cysteine via a thioester S-linkage (Linder and Deschenes, 2007; Hannoush and Sun, 2010). A major reason for this discrepancy is that mass spectrometry–based approaches to identify the native lipid specifically bound to S-acylated cysteines remain a significant challenge. This is particularly true for low abundance proteins such as mammalian ion channels, in contrast to the widespread application of mass spectrometry to directly identify native amino acids that are phosphorylated (Kordyukova et al., 2008, 2010; Sorek and Yalovsky, 2010; McClure et al., 2012; Ji et al., 2013). As such, direct biochemical demonstration of native cysteine S-acylation is lacking in most ion channels.

S-acylation and control of the ion channel lifecycle

Ion channel physiology is determined by both the number of channel proteins at the cognate membrane and by their activity and/or kinetics at the membrane. Evidence has begun to emerge that S-acylation of either pore-forming or regulatory subunits of ion channels controls all of these aspects of ion channel function. Although the focus of this review is S-acylation–dependent regulation of ion channel subunits itself, S-acylation also regulates the localization or activity of many adaptor, scaffolding, and cellular signaling proteins (e.g., G protein–coupled receptors [GPCRs], AKAP18, AKAP79/150, G proteins, etc.), as well as other aspects of cell biology that affect ion channel trafficking and the activity and regulation of macromolecular ion channel complexes (El-Husseini and Bredt, 2002; Linder and Deschenes, 2007; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Shipston, 2011; Resh, 2012).

Control of ion channel cell surface expression and spatial organization in membranes.

The control of ion channel trafficking, from synthesis in the ER through modification in the Golgi apparatus to subsequent delivery to the appropriate cellular membrane compartment, is a major mechanism whereby S-acylation modulates ion channel physiology. S-acylation may influence the number of ion channels resident in a membrane through regulation of distinct steps in the ion channel lifecycle (Fig. 2). Indeed S-acylation has been implicated in ion channel synthesis, as well as in channel trafficking to the membrane and subsequent internalization, recycling, and degradation. S-acylation controls the maturation and correct assembly of ion channels early in the biosynthetic pathway. For example, S-acylation regulates assembly of the ligand gated nicotinic acetylcholine receptor (nAChR) to ensure a functional binding site for acetylcholine (Alexander et al., 2010) as well as controlling its surface expression (Amici et al., 2012). S-acylation is also an important determinant of the maturation of both voltage-gated sodium (Nav1.2) and voltage-gated potassium channels (Kv1.5; Schmidt and Catterall, 1987; Zhang et al., 2007). S-acylation also contributes to the efficient trafficking of channels from the ER to Golgi and to post-Golgi transport. Three examples illustrate the importance and potential complexity of S-acylation in controlling ion channel trafficking:(1) S-acylation of a cysteine residue adjacent to a hydrophobic region (TM2) in a cytosolic loop of the GluA1 pore-forming subunit of AMPA receptors (Fig. 4 A) promotes retention of the channel in the Golgi (Hayashi et al., 2005). However, S-acylated Grip1b, a PDZ protein that binds to AMPA receptors, is targeted to mobile trafficking vesicles in neuronal dendrites and accelerates local recycling of AMPA receptors to the plasma membrane (Thomas et al., 2012). In contrast, S-acylation of another AMPA receptor interacting protein, PICK1, is proposed to stabilize AMPA receptor internalization (Thomas et al., 2013).(2) S-acylation of a cluster of cysteine residues juxtaposed to the transmembrane 4 domain (Cys I site) of the NMDA receptor subunit GluN2A (Fig. 4 B) increases surface expression of NMDA receptors by decreasing their constitutive internalization. In contrast S-acylation at C-terminal cysteine residues (Cys II site) decreases their surface expression by introducing a Golgi retention signal that decreases forward trafficking (Hayashi et al., 2009). Even though both sites affect surface expression, only S-acylation of the TM4 juxtaposed cysteine residues influences synaptic incorporation of NMDA receptors, which suggests that this site is an important determinant of the synaptic versus extrasynaptic localization of these ion channels (Mattison et al., 2012). Together, these data highlight the importance of S-acylation of two distinct sites within the same ion channel as well as that of components of the ion channel multimolecular complex as determinants of channel trafficking.(3) S-acylation of a cluster of cysteine residues in the intracellular S0-S1 loop of the pore-forming subunit (Figs. 4 C and and5)5) is required for efficient exit of BK channels from the ER and the trans-Golgi network. Deacylation at the Golgi apparatus appears to be an important regulatory step (Tian et al., 2012). BK channel surface abundance may also be controlled by S-acylation of regulatory β4 subunits. β4 subunit S-acylation on a cysteine residue juxtaposed to the second transmembrane domain is important for the ability of the β4 subunit itself to exit the ER. Importantly, assembly of β4 subunits with specific splice variants of pore-forming α subunits of the BK channel enhances surface expression of the channel, a mechanism that depends on S-acylation of the β4 subunit (Chen et al., 2013). Thus, in BK channels, S-acylation of the S0-S1 loop of the pore-forming subunit controls global BK channel surface expression, and β4 subunit S-acylation controls surface expression of specific pore-forming subunit splice variants. S-acylation of the Kchip 2 and Kchip 3 accessory subunits also controls surface expression of voltage-gated Kv4.3 channels (Takimoto et al., 2002).Moreover, S-acylation modulates the spatial organization of ion channels within membranes. Perhaps the most striking example involves aquaporin 4 (AQP4), where S-acylation of two N-terminal cysteine residues in an N-terminal splice variant (AQP4M1) inhibits assembly of AQP4 into large orthogonal arrays (Suzuki et al., 2008; Crane and Verkman, 2009), perhaps by disrupting interactions within the AQP4 tetramer. S-acylation can affect the distribution of the many membrane-associated proteins between cholesterol-rich microdomains (lipid rafts) and the rest of the membrane. Such clustering has also been reported for various transmembrane proteins, including the P2x purinoceptor 7 (P2X7) receptor, in which S-acylation of the C terminus promotes clustering into lipid rafts (Gonnord et al., 2009). A similar mechanism may underlie synaptic clustering of GABAA receptors mediated by S-acylation of an intracellular loop of the y2 subunit (Rathenberg et al., 2004). In these examples, S-acylation of the channel itself affects membrane partitioning and organization. However, recent evidence in neurons suggests that establishment of “nano” domains of ion channel complexes in postsynaptic membranes may also be established by local clustering of the cognate acyltransferase itself. For example, clustering of zDHHC2 in the postsynaptic membranes of individual dendritic spines provides a mechanism for local control of S-acylation cycles of the PDZ protein adapter, PSD-95, and thereby for controlling its association with the plasma membrane. PSD-95, in turn, can assemble with various ion channels, including NMDA receptors, and can thus dynamically regulate the localization and clustering of ion channel complexes (Fukata et al., 2013). Indeed, an increasing number of other ion channel scaffolding proteins such as Grip1 (Thomas et al., 2012), PICK1 (Thomas et al., 2013), S-delphilin (Matsuda et al., 2006), and Ankyrin G (He et al., 2012) that influence ion channel trafficking, clustering, and localization are now known to be S-acylated.Relatively few studies have identified effects of S-acylation on the intrinsic gating kinetics or pharmacology of ion channels at the plasma membrane. However, a glycine-to-cysteine mutant (G1079C) in the intracellular loop between domains II and III enhances the sensitivity of the voltage-gated Na channel Nav1.2a to the toxins PaurTx3 and ProTx-II, an effect blocked by inhibition of S-acylation. These toxins control channel activation through the voltage sensor in domain III. In addition, deacylation of another (wild-type) cysteine residue (C1182) in the II–III loop produces a hyperpolarizing shift in both activation and steady-state inactivation as well as slowing the recovery from fast inactivation and increasing sensitivity to PaurTx3 (Bosmans et al., 2011). Effects of S-acylation on gating kinetics have also been reported in other channels. For example, in the voltage-sensitive potassium channel Kv1.1, S-acylation of the intracellular linker between transmembrane domains 2 and 3 increases the intrinsic voltage sensitivity of the channel (Gubitosi-Klug et al., 2005). S-acylation of the β and γ subunits of epithelial sodium channels (ENaC) also affects channel gating (Mueller et al., 2010; Mukherjee et al., 2014), and the S-acylated regulatory β2a subunit of N-type calcium channels controls voltage-dependent inactivation (Qin et al., 1998; Hurley et al., 2000).S-acylation is also an important determinant of retrieving ion channels from the plasma membrane for recycling or degradation. S-acylation of a single cysteine residue juxtaposed to the transmembrane TM4 domain of GluA1 and GluA2 subunits of AMPA receptors controls agonist-induced ion channel internalization. These residues are distinct from those controlling Golgi retention of AMPA receptors (Fig. 4 A), which emphasizes the finding that the location and context of the S-acylated cysteines, even in the same protein, is central for their effects on physiological function (Hayashi et al., 2005; Lin et al., 2009; Yang et al., 2009). The stability of many proteins is also regulated by S-acylation; S-acylation of a single cysteine residue in Kv1.5 promotes both its internalization and its degradation (Zhang et al., 2007; Jindal et al., 2008). Thus, in different ion channels, S-acylation can have opposite effects on insertion, membrane stability, and retrieval.

S-acylation and posttranslational cross-talk control channel trafficking and activity.

An emerging concept is that S-acylation is an important determinant of ion channel regulation by other PTMs. Indeed, nearly 20 years ago it was reported that PKC-dependent phosphorylation of the GluK2 (GluR6) subunit of Kainate receptors was attenuated in channels S-acylated at cysteine residues near the PKC consensus site (Pickering et al., 1995). S-acylation of GluA1 subunits of AMPA receptors also blocks PKC phosphorylation of GluA1 and subsequently prevents its binding to the cytoskeletal adapter protein 4.1N, ultimately disrupting AMPA receptor insertion into the plasma membrane (Lin et al., 2009). Intriguingly, PKC phosphorylation and S-acylation have the opposite effect on 4.1N-mediated regulation of Kainate receptor (GluK2 subunit) membrane insertion: in this, case S-acylation promotes 4.1N interaction with Kainate receptors and thereby receptor insertion, whereas PKC phosphorylation disrupts 4.1N interaction, promoting receptor internalization (Copits and Swanson, 2013). Disruption of phosphorylation by S-acylation of residues near consensus phosphorylation sites likely results from steric hindrance, as proposed for S-acylation–dependent regulation of β2 adrenergic receptor phosphorylation (Mouillac et al., 1992; Moffett et al., 1993).S-acylation has also been reported to promote ion channel phosphorylation. For example, site-directed mutation of a cluster of palmitoylated cysteine residues in the GluN2A subunit of NMDA receptors abrogates Fyn-dependent tyrosine phosphorylation at a site between TM4 and the palmitoylated cysteines (Hayashi et al., 2009). Therefore, S-acylation of GluN2A promotes tyrosine phosphorylation, resulting in reduced internalization of the NMDA receptor (Hayashi et al., 2009). Furthermore, S-acylation of BK channels can act as a gate to switch channel regulation to different AGC family kinase signaling pathways, emphasizing the complex interactions that can occur between signaling pathways (Tian et al., 2008; Zhou et al., 2012; Fig. 5). S-acylation of an alternatively spliced insert (STREX) in the large cytosolic domain of the pore-forming subunit of BK channels promotes association of the STREX domain with the plasma membrane. S-acylation of the STREX insert is essential for the functional inhibition of STREX BK channels by PKA-mediated phosphorylation of a serine residue immediately upstream of the S-acylated cysteines. PKA phosphorylation dissociates the STREX domain from the plasma membrane (Tian et al., 2008), preventing STREX domain S-acylation (Jeffries et al., 2012) and leading to channel inhibition. However, deacylation of the STREX domain exposes a PKC consensus phosphorylation site downstream of the STREX domain, allowing PKC to inhibit STREX BK channels (Zhou et al., 2012). Thus, S-acylation acts as a reversible switch to specify regulation by AGC family kinases through control of the membrane association of a cytosolic domain of the channel: S-acylated STREX BK channels are inhibited by PKA but insensitive to PKC, whereas deacylated channels are inhibited by PKC but not PKA (Fig. 5). The reciprocal control of membrane association of a protein domain by S-acylation and protein phosphorylation likely represents a common mechanism in other signaling proteins as revealed for phosphodiesterase 10A (Charych et al., 2010).Cysteine residues are targets for several other modifications that regulate various ion channels, including nitrosylation, sulphydration, REDOX regulation, and formation of disulphide bonds (Sen and Snyder, 2010). Evidence is beginning to emerge that S-acylation may mutually compete with these mechanisms, providing a dynamic network to control cysteine reactivity. For example, the ion channel scaffolding PDZ domain protein PSD-95 is S-acylated at two N-terminal cysteine residues (C3 and C5) that are required for membrane targeting and clustering of PSD-95 (El-Husseini et al., 2002). nNOS also interacts with PSD-95, and stimulation of nitric oxide production results in nitrosylation of these cysteines, preventing their S-acylation and thereby decreasing PSD-95 clusters at postsynaptic sites (Ho et al., 2011). A recent remarkable example of the potential for such cross-talk in ion channel subunits is the identification of the S-acylation of 18 different cysteine residues in the large cytosolic N terminus of RyR1 in skeletal muscle. Of these 18 S-acylated cysteines, six have previously been identified as targets for S-oxidation, and a further cysteine residue was also subject to S-nitrosylation (Chaube et al., 2014) Although the functional relevance of this potential cross-talk in RyR1 has yet to be defined, interaction between oxidation and S-acylation of the same cysteine residue is physiologically relevant in other proteins. For example, oxidation of the signaling protein HRas at two cysteine residues C181/184 prevents S-acylation of these residues, resulting in a loss of plasma membrane localization of this peripheral membrane signaling protein (Burgoyne et al., 2012). Intriguingly, a conserved cysteine residue in nAChR α3 subunits, which has been shown to be S-acylated (C273) in the nAChR α4 subunit, has been implicated in use-dependent inactivation of nAChRs by reactive oxygen species (Amici et al., 2012). Determining whether these mutually competitive cysteine modifications represent an important mechanism for regulation of a range of ion channels is an exciting challenge for the future.S-acylation is also an important determinant of ion channel regulation by heterotrimeric G proteins. This can involve S-acylation of either G protein targets or of regulators of G proteins. In an example of the former, the palmitoylated N terminus of the regulatory β2a subunit splice variant acts as a steric inhibitor of an arachidonic acid binding domain to stimulate N-type calcium channels (Chien et al., 1996; Heneghan et al., 2009; Mitra-Ganguli et al., 2009). When the regulatory β subunits are not S-acylated, however, Gq-mediated signaling, via arachidonic acid, inhibits calcium channel activity. Closure of G protein regulated inward rectifying potassium (GIRK) channels in neurons after Gi/o deactivation provides an example of the latter (Jia et al., 2014). Signaling by members of the Gi/o family of the Gα subunit of heterotrimeric G proteins is terminated by members of the regulator of G protein signaling 7 (R7 RGS) family of GTPase-activating proteins, which accelerate GTP hydrolysis to speed Gi/o deactivation. Membrane localization of regulator of G protein signaling 7 (R7-RGS) is required for its regulation of Gi/o, and this is determined by interaction with an S-acylated R7 binding protein (R7-BP) that acts as an allosteric activator. Thus, the R7-RGS complex, recruited to the plasma membrane by S-acylated R7-BP, promotes Gi/o deactivation to facilitate GIRK channel closure. Conversely, deacylation of R7-BP removes the R7-GS complex from the plasma membrane, slowing Gi/o deactivation and consequent channel closure (Jia et al., 2014). Clearly, as S-acylation can also control an array of GPCRs, enzymes, and signaling and adapter proteins that indirectly control ion channel function (El-Husseini and Bredt, 2002; Linder and Deschenes, 2007; Fukata and Fukata, 2010; Greaves and Chamberlain, 2011; Shipston, 2011; Resh, 2012), understanding how S-acylation dynamically controls other components of ion channel multimolecular signaling complexes will be an essential future goal.

Summary and perspectives

With an ever-expanding “catalog” of S-acylated ion channel pore-forming and regulatory subunits (∼50 to date), together with an array of S-acylated scaffolding and signaling proteins, the importance and ubiquity of this reversible covalent lipid modification in controlling the lifecycle and physiological function and regulation of ion channels is unquestionable. This has been paralleled by a major resurgence in the wider S-acylation field, a consequence in large part of the discovery of S-acylating and deacylating enzymes together with a growing arsenal of genetic, proteomic, imaging, and pharmacological tools to assay and interrogate S-acylation function.As for most other posttranslational modifications of ion channels, including phosphorylation, major future goals for the field include:(1) Understanding mechanistically how covalent addition of a fatty acid can control such a diverse array of ion channel protein properties and functions, and how this is spatiotemporally regulated.(2) Elucidating the physiological relevance of this posttranslational modification from the level of single ion channels to the functional role of the channel in the whole organism in health and disease.Elucidation of these issues has fundamental implications far beyond ion channel physiology.To address these goals several major challenges and questions must be addressed, including:(1) It is largely assumed that S-acylation of transmembrane proteins results in an additional “membrane anchor” to target domains to the membrane interface. However, understanding the mechanisms, forces, and impact of S-acylation on the orientation of transmembrane helices and the architecture and structure of disordered domains in cytosolic loops and linkers, while remaining a considerable technical challenge, should provide major insight into mechanisms controlling channel trafficking, activity, and regulation.(2) Although S-acylation is widely accepted to be reversible, its spatiotemporal regulation of most ion channels is unknown. Mechanistic insight into zDHHC and acylthioesterase substrate specificity, native subcellular localization, and assembly with ion channel signaling complexes will allow us to dissect and understand how S-acylation of ion channels is controlled. Importantly, this should allow us to take both “channel-centric” (e.g., site-directed mutagenesis of S-acylated cysteines) as well as “S-acylation centric” (e.g., knockout of specific zDHHC activity) approaches to understand how multisite S-acylation on the same ion channel subunit can control distinct functions as well as physiological regulation of trafficking and function at the plasma membrane.(3) The functional role of S-acylation cannot be viewed in isolation from other posttranslational modifications. The cross-talk between S-acylation and adjacent phosphorylation sites as well as other cysteine modifications highlights the importance of understanding the interactions between signaling pathways. Insight into the rules, mechanisms, and cross-talk of S-acylation with these modifications has broad implications for cellular signaling.(4) Although it is clear that disruption of S-acylation homeostasis itself has substantial effects on normal physiology, and we are beginning to understand some of the cellular functions of ion channel S-acylation, we know very little about the functional impact of disrupted ion channel S-acylation at the systems and organismal level. Understanding how this may be dynamically regulated during a lifespan is critical to understanding the role of S-acylation in health and disease.To address these issues, development of improved tools to assay and investigate S-acylation from the single protein to organism is required. For example, tools to allow the real-time analysis of S-acylation status of ion channels in cells and tissues will provide fundamental insights into its dynamics and role in ion channel trafficking and membrane localization. Improved proteomic tools will allow direct assay of fatty acids bound to cysteine residues via thioester linkages. Development of new tools and models are essential if we are to understand the physiological relevance of ionic channel S-acylation at the systems level. These include: specific inhibitors of zDHHCs and thioesterases, conditional knockouts to spatiotemporally control zDHHC expression, and transgenics expressing catalytically inactive zDHHCs and models expressing S-acylation–null ion channel subunits. Furthermore, our understanding of how S-acylation may be dynamically controlled during normal ageing in response to homeostatic challenge and disruption in disease states remains rudimentary. Whether we will start to uncover channel “S-acylationopathies” resulting from dysregulation of ion channel S-acylation, analogous to channel phosphorylopathies, remains to be explored. Addressing these issues, together with development of new tools, will provide a paradigm shift in our understanding of both ion channel and S-acylation physiology, and promises to reveal novel therapeutic strategies for a diverse array of disorders.  相似文献   

11.
Kv5, Kv6, Kv8, and Kv9 subunits: No simple silent bystanders     
Elke Bocksteins 《The Journal of general physiology》2016,147(2):105-125
  相似文献   

12.
Uniform nomenclature for the mitochondrial contact site and cristae organizing system     
Nikolaus Pfanner  Martin van der Laan  Paolo Amati  Roderick A. Capaldi  Amy A. Caudy  Agnieszka Chacinska  Manjula Darshi  Markus Deckers  Suzanne Hoppins  Tateo Icho  Stefan Jakobs  Jianguo Ji  Vera Kozjak-Pavlovic  Chris Meisinger  Paul R. Odgren  Sang Ki Park  Peter Rehling  Andreas S. Reichert  M. Saeed Sheikh  Susan S. Taylor  Nobuo Tsuchida  Alexander M. van der Bliek  Ida J. van der Klei  Jonathan S. Weissman  Benedikt Westermann  Jiping Zha  Walter Neupert  Jodi Nunnari 《The Journal of cell biology》2014,204(7):1083-1086
The mitochondrial inner membrane contains a large protein complex that functions in inner membrane organization and formation of membrane contact sites. The complex was variably named the mitochondrial contact site complex, mitochondrial inner membrane organizing system, mitochondrial organizing structure, or Mitofilin/Fcj1 complex. To facilitate future studies, we propose to unify the nomenclature and term the complex “mitochondrial contact site and cristae organizing system” and its subunits Mic10 to Mic60.Mitochondria possess two membranes of different architecture and function (Palade, 1952; Hackenbrock, 1968). Both membranes work together for essential shared functions, such as protein import (Schatz, 1996; Neupert and Herrmann, 2007; Chacinska et al., 2009). The outer membrane harbors machinery that controls the shape of the organelle and is crucial for the communication of mitochondria with the rest of the cell. The inner membrane harbors the complexes of the respiratory chain, the F1Fo-ATP synthase, numerous metabolite carriers, and enzymes of mitochondrial metabolism. It consists of two domains: the inner boundary membrane, which is adjacent to the outer membrane, and invaginations of different shape, termed cristae (Werner and Neupert, 1972; Frey and Mannella, 2000; Hoppins et al., 2007; Pellegrini and Scorrano, 2007; Zick et al., 2009; Davies et al., 2011). Tubular openings, termed crista junctions (Perkins et al., 1997), connect inner boundary membrane and cristae membranes (Fig. 1, A and B). Respiratory chain complexes and the F1Fo-ATP synthase are preferentially located in the cristae membranes, whereas preprotein translocases are enriched in the inner boundary membrane (Vogel et al., 2006; Wurm and Jakobs, 2006; Davies et al., 2011). Contact sites between outer membrane and inner boundary membrane promote import of preproteins, metabolite channeling, lipid transport, and membrane dynamics (Frey and Mannella, 2000; Sesaki and Jensen, 2004; Hoppins et al., 2007, 2011; Neupert and Herrmann, 2007; Chacinska et al., 2009; Connerth et al., 2012; van der Laan et al., 2012).Open in a separate windowFigure 1.MICOS complex. (A) The MICOS complex (hypothetical model), previously also termed MINOS, MitOS, or Mitofilin/Fcj1 complex, is required for maintenance of the characteristic architecture of the mitochondrial inner membrane (IM) and forms contact sites with the outer membrane (OM). In budding yeast, six subunits of MICOS have been identified. All subunits are exposed to the intermembrane space (IMS), five are integral inner membrane proteins (Mic10, Mic12, Mic26, Mic27, and Mic60), and one is a peripheral inner membrane protein (Mic19). Mic26 is related to Mic27; however, mic26Δ yeast cells show considerably less severe defects of mitochondrial inner membrane architecture than mic27Δ cells (Harner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011). The MICOS complex of metazoa additionally contains Mic25, which is related to Mic19, yet subunits corresponding to Mic12 and Mic26 have not been identified so far. MICOS subunits that have been conserved in most organisms analyzed are indicated by bold boundary lines. (B, top) Wild-type architecture of the mitochondrial inner membrane with crista junctions and cristae. (bottom) This architecture is considerably altered in micos mutant mitochondria: most cristae membranes are detached from the inner boundary membrane and form internal membrane stacks. In some micos mutants (deficiency of mammalian Mic19 or Mic25), a loss of cristae membranes was observed (Darshi et al., 2011; An et al., 2012). Figure by M. Bohnert (Institute of Biochemistry and Molecular Biology, University of Freiburg, Freiburg, Germany).To understand the complex architecture of mitochondria, it will be crucial to identify the molecular machineries that control the interaction between mitochondrial outer and inner membranes and the characteristic organization of the inner membrane. A convergence of independent studies led to the identification of a large heterooligomeric protein complex of the mitochondrial inner membrane conserved from yeast to humans that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane (Fig. 1 A). Several names were used by different research groups to describe the complex, including mitochondrial contact site (MICOS) complex, mitochondrial inner membrane organizing system (MINOS), mitochondrial organizing structure (MitOS), Mitofilin complex, or Fcj1 (formation of crista junction protein 1) complex (Harner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Alkhaja et al., 2012). Mitofilin, also termed Fcj1, was the first component identified (Icho et al., 1994; Odgren et al., 1996; Gieffers et al., 1997; John et al., 2005) and was observed enriched at crista junctions (Rabl et al., 2009). Mutants of Mitofilin/Fcj1 as well as of other MICOS/MINOS/MitOS subunits show a strikingly altered inner membrane architecture. They lose crista junctions and contain large internal membrane stacks, the respiratory activity is reduced, and mitochondrial DNA nucleoids are altered (Fig. 1 B; John et al., 2005; Hess et al., 2009; Rabl et al., 2009; Mun et al., 2010; Harner et al., 2011; Head et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Alkhaja et al., 2012; Itoh et al., 2013). It has been reported that the complex interacts with a variety of outer membrane proteins, such as channel proteins and components of the protein translocases and mitochondrial fusion machines, and defects impair the biogenesis of mitochondrial proteins (Xie et al., 2007; Darshi et al., 2011; Harner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Alkhaja et al., 2012; An et al., 2012; Bohnert et al., 2012; Körner et al., 2012; Ott et al., 2012; Zerbes et al., 2012; Jans et al., 2013; Weber et al., 2013). The MICOS/MINOS/MitOS/Mitofilin/Fcj1 complex thus plays crucial roles in mitochondrial architecture, dynamics, and biogenesis. However, communication of results in this rapidly developing field has been complicated by several different nomenclatures used for the complex as well as for its subunits (Standard nameFormer namesYeast ORFReferencesComplexMICOSMINOS, MitOS, MIB, Mitofilin complex, and Fcj1 complexXie et al., 2007; Rabl et al., 2009; Darshi et al., 2011; Harner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Alkhaja et al., 2012; An et al., 2012; Bohnert et al., 2012; Ott et al., 2012; Jans et al., 2013; Weber et al., 2013SubunitsMic10Mcs10, Mio10, Mos1, and MINOS1YCL057C-AHarner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Alkhaja et al., 2012; Itoh et al., 2013; Jans et al., 2013; Varabyova et al., 2013Mic12Aim5, Fmp51, and Mcs12YBR262CHess et al., 2009; Harner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Varabyova et al., 2013Mic19Aim13, Mcs19, CHCH-3, CHCHD3, and MINOS3YFR011CXie et al., 2007; Hess et al., 2009; Darshi et al., 2011; Head et al., 2011; Alkhaja et al., 2012; Ott et al., 2012; Jans et al., 2013; Varabyova et al., 2013Mic25 (metazoan Mic19 homologue)CHCHD6 and CHCM1Xie et al., 2007; An et al., 2012Mic26Mcs29, Mio27, and Mos2YGR235CHarner et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011Mic27Aim37, Mcs27, APOOL, and MOMA-1YNL100WHess et al., 2009; Harner et al., 2011; Head et al., 2011; Hoppins et al., 2011; von der Malsburg et al., 2011; Weber et al., 2013Mic60Fcj1, Aim28, Fmp13, Mitofilin, HMP, IMMT, and MINOS2YKR016WIcho et al., 1994; Odgren et al., 1996; Gieffers et al., 1997; John et al., 2005; Wang et al., 2008; Rabl et al., 2009; Rossi et al., 2009; Mun et al., 2010; Park et al., 2010; Körner et al., 2012; Zerbes et al., 2012; Itoh et al., 2013; Varabyova et al., 2013Open in a separate windowAPOOL, apolipoprotein O–like; HMP, heart muscle protein; IMMT, inner mitochondrial membrane protein; MIB, mitochondrial intermembrane space bridging.To rectify this situation, all authors of this article have agreed on a new uniform nomenclature with the following guidelines. (a) The complex will be called “mitochondrial contact site and cristae organizing system” (MICOS). The protein subunits of MICOS are named Mic10 to Mic60 as listed in Gabriel et al., 2007; Vögtle et al., 2012) will be changed to Mix14, Mix17, and Mix23 (mitochondrial intermembrane space CXnC motif proteins) in the Saccharomyces Genome Database, and the new nomenclature will be used for orthologues identified in other organisms.The MICOS complex is of central importance for the maintenance of mitochondrial inner membrane architecture and the formation of contact sites between outer and inner membranes and thus is involved in the regulation of mitochondrial dynamics, biogenesis, and inheritance. We expect that the uniform nomenclature will facilitate future studies on mitochondrial membrane architecture and dynamics.  相似文献   

13.
Tethering Factors Required for Cytokinesis in Arabidopsis     
Martha Thellmann  Katarzyna Rybak  Knut Thiele  Gerhard Wanner  Farhah F. Assaad 《Plant physiology》2010,154(2):720-732
  相似文献   

14.
Mitotic spindle (DIS)orientation and DISease: Cause or consequence?     
Anna Noatynska  Monica Gotta  Patrick Meraldi 《The Journal of cell biology》2012,199(7):1025-1035
  相似文献   

15.
Quality control mechanisms that protect nuclear envelope identity and function     
Philip J. Mannino  C. Patrick Lusk 《The Journal of cell biology》2022,221(9)
  相似文献   

16.
Where is mTOR and what is it doing there?     
Charles Betz  Michael N. Hall 《The Journal of cell biology》2013,203(4):563-574
  相似文献   

17.
Cell biology in neuroscience: RNA-based mechanisms underlying axon guidance     
Toshiaki Shigeoka  Bo Lu  Christine E. Holt 《The Journal of cell biology》2013,202(7):991-999
  相似文献   

18.
The Golgi and the centrosome: building a functional partnership     
Christine Sütterlin  Antonino Colanzi 《The Journal of cell biology》2010,188(5):621-628
The mammalian Golgi apparatus is characterized by a ribbon-like organization adjacent to the centrosome during interphase and extensive fragmentation and dispersal away from the centrosome during mitosis. It is not clear whether this dynamic association between the Golgi and centrosome is of functional significance. We discuss recent findings indicating that the Golgi–centrosome relationship may be important for directional protein transport and centrosome positioning, which are both required for cell polarization. We also summarize our current knowledge of the link between Golgi organization and cell cycle progression.

Introduction

The Golgi apparatus plays a central role in the secretory pathway. Newly synthesized proteins are transported from the ER to the Golgi, where they are posttranslationally modified. They are sorted into carriers for delivery to the plasma membrane or the endosomal–lysosomal system. The basic structural unit of the Golgi apparatus is a stack of flattened cisternae that is morphologically conserved among most species. In mammalian cells, individual Golgi stacks are connected laterally to form a continuous membranous system called the Golgi ribbon, which is located in close physical proximity to the centrosome (Fig. 1, left).Open in a separate windowFigure 1.The spatial relationship between the Golgi and the centrosome during the mammalian cell cycle. Golgi (red, stained with antibodies to GM130) and centrosome (green, stained with antibodies to centrin) staining of nonsynchronized bone cancer cells (U2-OS) shows the physical proximity between these two organelles during interphase (left) and its temporary loss during mitosis (right). Bar, 10 µm.The centrosome functions as the major microtubule-organizing center of the cell and plays an important role in cell polarization and ciliogenesis (Bettencourt-Dias and Glover, 2007). In a newly formed daughter cell, this nonmembrane-bound organelle is composed of a pair of centrioles that is surrounded by a cloud of electron-dense material called the pericentriolar matrix. γ-Tubulin ring complexes (γ-TuRCs) in the pericentriolar matrix allow the centrosome to nucleate the radial array of interphase microtubules whose minus ends are embedded in the centrosome and whose plus ends extend toward the cell periphery. After centrosome duplication in S phase, the two centrosomes move to opposite poles of the cell and become the spindle poles from which spindle microtubules grow. Centrosomes are generally located in the cell center close to the nucleus, although this central position is lost in response to a polarization stimulus, which prompts centrosomes to reorient toward the leading edge of the cell (Pouthas et al., 2008). In most cell types, centrosome reorientation is critical for the ability of cells to polarize and migrate (Yvon et al., 2002). The centrosome is also linked to ciliogenesis because one of its centrioles is converted into the basal body from which a primary cilium extends (D''Angelo and Franco, 2009).The spatial relationship between the Golgi apparatus and the centrosome is altered by changes in Golgi organization that occur during the cell cycle (Fig. 1). These two organelles are only adjacent in interphase when the Golgi apparatus is arranged as a ribbon in the pericentriolar region (Colanzi et al., 2003). In contrast, Golgi membranes are fragmented and dispersed throughout the cytoplasm during mitosis. Intriguingly, the pericentriolar localization of the Golgi is a feature typical of some eukaryotic cells, ranging from mammalian and amphibian cells (Thyberg and Moskalewski, 1999; Reilein et al., 2003) to amoeba (Rehberg et al., 2005). However, other eukaryotes, including plants and flies, have isolated Golgi stacks (Stanley et al., 1997; Nebenführ and Staehelin, 2001) or isolated cisternae in the case of Saccharomyces cerevisiae that are scattered throughout the cytoplasm without an obvious connection with the centrosome (Preuss et al., 1992).In this paper, we review recent findings indicating that the relationship between the Golgi and the centrosome in interphase is important for cell polarization. We also summarize the current understanding of how Golgi–centrosome interactions during mitosis affect cell division.

Are there functional interactions between the Golgi and the centrosome during interphase?

Golgi membranes are actively positioned in the pericentriolar position.

The localization of the mammalian Golgi ribbon next to the centrosome requires the microtubule and actin cytoskeleton (Brownhill et al., 2009). Microtubules have a dual role in organizing the pericentriolar Golgi ribbon. First, the subset of microtubules that is nucleated at the Golgi is necessary for the assembly of Golgi fragments into a connected ribbon in the cell periphery (Miller et al., 2009). Second, centrosomal microtubules provide the tracks along which Golgi membranes are transported to the cell center (Cole et al., 1996). Both steps depend on the minus end–directed motor complex dynein (Burkhardt et al., 1997; Miller et al., 2009). The actin cytoskeleton is also involved in localizing Golgi membranes. Actin fibers, which have been detected at the Golgi complex, are required for the maintenance of the pericentriolar position of this organelle by providing tracks for actin-based motors (Valderrama et al., 1998; Sahlender et al., 2005; Vicente-Manzanares et al., 2007). Actin fibers and microtubules are coordinated by proteins that associate with both cytoskeletal elements such as WHAMM, a Golgi-bound actin-nucleating factor, and MACF1, a microtubule–actin cross-linking protein (Lin et al., 2005; Campellone et al., 2008).Golgi organization and localization in the pericentriolar region also depend on Golgi-associated proteins (Ramirez and Lowe, 2009). Their depletion produces defects in Golgi organization ranging from a disconnected Golgi ribbon in the pericentriolar region (Puthenveedu et al., 2006) to dispersed ministacks in the cytoplasm (Diao et al., 2003; Yadav et al., 2009).

Table I.

Golgi-associated proteins that control the pericentriolar position of the Golgi apparatus
Golgi-associated proteinsReference
Structural Golgi proteins
Cog3Zolov and Lupashin, 2005
GCC185Derby et al., 2007
GCP60 (ACBD3)Sohda et al., 2001
GM130Marra et al., 2007
Golgin-45Short et al., 2001
Golgin-84Diao et al., 2003
Golgin-97Lu et al., 2004
Golgin-160Yadav et al., 2009
Golgin-245Yoshino et al., 2005
GRASP55Feinstein and Linstedt, 2008
GRASP65Puthenveedu et al., 2006
p115Sohda et al., 2005
Membrane traffic
RINT-1Sun et al., 2007
Syntaxin 5Suga et al., 2005
ZW10Sun et al., 2007
Cytoskeleton regulators and motors
ARHGAP10Dubois et al., 2005
CG-NAP/AKAP450Takahashi et al., 1999
CLASP2Efimov et al., 2007
Coronin 7Rybakin et al., 2006
GMAP-210Ríos et al., 2004
FTCDGao and Sztul, 2001
Hook3Walenta et al., 2001
MACF1bLin et al., 2005
Myosin IIVicente-Manzanares et al., 2007
Myosin VISahlender et al., 2005
OptineurinSahlender et al., 2005
p50/dynamitinRoghi and Allan, 1999
WHAMMCampellone et al., 2008
Kinases and enzymes
Cdk5 (kinase)Sun et al., 2008
ORP9 (lipid transfer)Ngo and Ridgway, 2009
PKA (kinase)Bejarano et al., 2006
PKD1 (kinase)Díaz Añel and Malhotra, 2005
Sac1 (PI phosphatase)Liu et al., 2008
Open in a separate windowAlthough the position of the Golgi next to the centrosome is actively maintained, it does not appear to be critical for basic Golgi functions. For example, membrane trafficking and the modification of secretory proteins are unaffected when the Golgi ribbon is severed into individual ministacks (Cole et al., 1996; Diao et al., 2003; Yadav et al., 2009). Furthermore, organisms such as S. cerevisiae secrete proteins with high efficiency, although their Golgi membranes are never pericentriolar (Preuss et al., 1992). Thus, the physiological role of the pericentrosomal positioning of the mammalian Golgi apparatus remains a major unanswered question.

An emerging role for Golgi–centrosome association in polarized secretion.

New studies indicate that the relationship between the Golgi and the centrosome may be important for specialized functions of mammalian cells. A prominent example is cell polarization, which is a prerequisite for cell migration (Li et al., 2005). Cell polarization depends on directional protein transport along Golgi-nucleated microtubules as well as centrosome reorientation toward the leading edge of the cell, which both appear to be affected by interactions between the Golgi and the centrosome.In a recent study, Yadav et al. (2009) investigated the role of the pericentriolar Golgi ribbon in directional transport and cell polarization. Depletion of each of the two structural proteins of the golgin family, GMAP210 and Golgin-160, disrupted the ribbon-like structure of the Golgi and led to isolated ministacks in the cytoplasm. These dispersed stacks were competent of general protein transport to the cell surface. However, there were defects in directional protein transport, as shown by the failure to secrete vesicular stomatitis virus G protein in a directional manner toward the leading edge of a cell and the inability of these cells to migrate in a wound-healing assay. These results indicate that the pericentriolar Golgi ribbon is critical for directional protein transport, although it is not clear whether it is the ribbon-like organization or the position next to the centrosome that is important.Golgi–centrosome interactions may also contribute to cell polarization through regulatory effects on centrosome positioning. Both the centrosome and the Golgi apparatus undergo reorientation toward the leading edge of a stimulated cell. Bisel et al. (2008) found that centrosome reorientation depends on phosphorylation of the Golgi protein GRASP65, which is proposed to promote Golgi stack disassembly (Wang et al., 2003; Yoshimura et al., 2005). In this study, expression of nonphosphorylatable forms of GRASP65 prevented Golgi and centrosome reorientation toward the leading edge and cell migration. Intriguingly, this block was overcome when Golgi membranes were artificially fragmented, indicating that Golgi membranes have to be remodeled to allow the coordinated reorientation of the centrosome and the Golgi. Thus, the ability of the Golgi to reorganize affects the positioning of the centrosome (Bisel et al., 2008).The peripheral Golgi protein, GM130, is an additional critical factor in the regulation of cell polarization (Preisinger et al., 2004; Kodani et al., 2009; Rivero et al., 2009). There are at least four reasons to explain why depletion of GM130 prevents cells from polarizing and migrating in wound-healing assays (Kodani et al., 2009). First, Kodani and Sütterlin (2008) showed that GM130 depletion altered the organization of the centrosome so that it was no longer able to nucleate microtubules or to reorient in response to a polarization stimulus. Second, GM130-dependent centrosome regulation involved the small GTPase Cdc42 (Kodani et al., 2009), a known regulator of cell polarization (Etienne-Manneville, 2006; Kodani et al., 2009). Third, Rivero et al. (2009) identified a novel role for GM130 in microtubule nucleation at the Golgi, which required GM130-dependent recruitment of the microtubule nucleation factor AKAP450 to the Golgi (Rivero et al., 2009). Golgi-nucleated microtubules, which were first identified in in vitro studies (Chabin-Brion et al., 2001), are preferentially oriented toward the leading edge of a motile cell and are necessary for directional protein transport (Fig. 2; Rivero et al., 2009). Fourth, GM130 binds and activates the protein kinase YSK1, which has a known role in cell migration (Preisinger et al., 2004). Thus, GM130 may affect cell polarization and migration through effects on centrosome organization, Cdc42 activation, microtubule nucleation at the Golgi, and YSK1 activation.Open in a separate windowFigure 2.Golgi- and centrosome-nucleated microtubules in cell migration. The centrosome nucleates a radial array of microtubules (red) whose minus ends (−) are anchored at the centrosome and whose plus ends (+) extend into the cell periphery. This population of microtubules depends on γ-TuRC complexes and the large scaffold protein AKAP450 for their nucleation and functions in maintaining the pericentriolar localization of the Golgi ribbon by a dynein-mediated mechanism (closed arrows). In contrast, the Golgi apparatus nucleates microtubules (brown) that extend asymmetrically toward the leading edge of a migrating cell. Microtubule nucleation at the Golgi requires the peripheral Golgi protein GM130, which recruits AKAP450 and γ-TuRC complexes to the Golgi apparatus. Golgi-nucleated microtubules are coated with CLASP proteins and are necessary for the formation of the Golgi ribbon from dispersed stacks. In addition, they are required for cell migration by facilitating polarized protein transport to the leading edge of a cell (open arrows).The formation of a primary cilium is another process that involves interactions between the Golgi and the centrosome. During ciliogenesis, the centrosome moves to the plasma membrane, where one of its centrioles becomes the basal body from which the primary cilium extends. IFT20, a critical component of the intraflagellar transport machinery that is required for formation and extension of the cilium (Follit et al., 2006), localizes to the Golgi by binding to the structural Golgi protein GMAP210. Loss of either IFT20 or GMAP210 impairs ciliogenesis (Follit et al., 2006, 2008), which supports a role for Golgi-localized IFT20 in protein sorting at the Golgi to produce transport carriers involved in the formation of a primary cilium. A similar role in directing specific cargo molecules to the ciliary membrane has been proposed for the small GTPase Rab8, which also localizes to the Golgi and the basal body (Nachury et al., 2007). Collectively, these new findings are intriguing, as they provide support for a functional link between the Golgi and the centrosome.

Are there functional interactions between the Golgi and the centrosome during mitosis?

Regulation of mitotic Golgi reorganization from the centrosome.

The physical proximity of the Golgi apparatus and the centrosome is transiently lost during mitosis when Golgi membranes undergo extensive fragmentation. This dramatic change in Golgi structure is concomitant with a block in secretory trafficking and the reorganization of the microtubule cytoskeleton (Colanzi et al., 2003). Although the Golgi and the centrosome are physically separate at this stage of the cell cycle, there is evidence for functional interactions between these two organelles, which may control progression through mitosis.Many studies have identified possible links between mitotic Golgi fragmentation and the centrosome. For instance, breaking the Golgi ribbon into its constituent stacks during G2 requires the activity of the protein kinase Plk3 (Xie et al., 2004; López-Sánchez et al., 2009), which localizes to the centrosome and spindle poles (Xie et al., 2004; Jiang et al., 2006). The subsequent conversion of Golgi stacks into small, highly dispersed fragments (Jesch et al., 2001; Altan-Bonnet et al., 2006) and vesicular/tubular clusters next to astral spindle microtubules (Shima et al., 1998; Wei and Seemann, 2009) is regulated by two mitotic kinases, Cdk1 and Plk1, which are both associated with the centrosome (Fig. 3; Bailly et al., 1989; Dai and Cogswell, 2003). These findings suggest that components of the centrosome, spindle poles, or the spindle may initiate a signaling pathway that leads to the fragmentation of the Golgi and that may help coordinate Golgi dynamics with cell cycle progression. However, these regulatory factors also exist in the cytosol, and possible roles of cytosolic pools of Cdk1 and Plk3 in mitotic Golgi fragmentation have not been excluded.Open in a separate windowFigure 3.Golgi fragmentation during mitosis. The mammalian Golgi apparatus (green) forms an interconnected ribbon adjacent to the centrosome (red) and the nucleus (blue). It nucleates a population of microtubules that is necessary for polarized protein transport. Plus (+) and minus ends (−) are indicated. The activities of the protein kinases Plk3 and MEK1 and the fission protein BARS are required to convert the ribbon structure into isolated stacks in late G2 and prophase. In metaphase, the isolated stacks are further fragmented by a Plk1- and Cdk1-dependent mechanism, producing vesicular/tubular membranes that are dispersed throughout the cytoplasm. During this process, ribbon determinants, which are proteins required for postmitotic Golgi ribbon formation, remain associated with the mitotic spindle for their partitioning into daughter cells. Centrosome-associated regulators of mitotic Golgi fragmentation are labeled in red. Regulators of Golgi fragmentation that are not associated with the centrosome are labeled in black.Further support for functional interactions between the Golgi and the centrosome during mitosis stems from a novel study on spindle-dependent reassembly of the Golgi ribbon after mitosis (Wei and Seemann, 2009). In a series of elegant experiments, Wei and Seemann (2009) demonstrated that the spindle is required for the postmitotic reformation of the Golgi ribbon. They induced asymmetric cell division so that the entire spindle segregated into only one daughter cell. Although Golgi membranes assembled into stacks in both daughter cells, they only formed a ribbon in the cell that inherited the spindle. Ribbon formation in the spindle-free cell required coinjection of Golgi extracts and tubulin or the addition of spindle-containing fractions. Collectively, these results suggest that Golgi ribbon formation occurs in two steps, with the initial assembly into stacks being mediated by factors that are partitioned by a spindle-independent mechanism. The subsequent formation of the Golgi ribbon from individual stacks, however, has an additional requirement for ribbon determinants, which are likely to be Golgi-associated proteins inherited with the spindle. Possible candidates include regulators of Golgi dynamics and the secretory pathway that have been identified in preparations of the spindle matrix (Ma et al., 2009).

Significance of the loss of Golgi–centrosome proximity during mitosis.

Several studies have identified an unexpected link between mitotic Golgi fragmentation and cell cycle progression (Sütterlin et al., 2002; Hidalgo Carcedo et al., 2004; Preisinger et al., 2005). For example, interfering with mitotic Golgi disassembly by blocking the function of the peripheral Golgi protein GRASP65 or the fission protein BARS resulted in cell cycle arrest in G2 (Sütterlin et al., 2002; Hidalgo Carcedo et al., 2004). Intriguingly, breaking the ribbon into isolated stacks, which occurs in G2, is sufficient to overcome this cell cycle arrest and allows cells to enter mitosis (Colanzi et al., 2007; Feinstein and Linstedt, 2007). It is not known how and why the presence of an intact pericentriolar Golgi ribbon prevents mitotic entry. The existence of a Golgi checkpoint, which monitors the correct inheritance of the Golgi complex, has been proposed because these inhibitory effects are not caused by activation of the DNA damage checkpoint (Sütterlin et al., 2002; Hidalgo Carcedo et al., 2004). It is conceivable that severing the Golgi ribbon in G2 separates ribbon determinants from the rest of the Golgi so that they can cosegregate with the spindle (Fig. 3). Such a mechanism for spindle-dependent Golgi inheritance would ensure that both daughter cells inherit the ability to form a Golgi ribbon and, thus, to transport proteins in a polarized manner. By analogy to the spindle checkpoint, which controls the exit from mitosis by monitoring the correct binding of spindle microtubules to kinetochores, this Golgi checkpoint may assess binding of spindle microtubules to these putative ribbon determinants to regulate entry into mitosis.

Golgi-dependent regulation of the spindle and mitotic progression.

A series of recent studies has identified a requirement for specific Golgi-associated proteins in the formation of a bipolar spindle (Chang et al., 2005), the putative Golgi stacking factor, GRASP65 (Sütterlin et al., 2005), a regulator of the spindle checkpoint, RINT-1 (Lin et al., 2007), and the phosphatidylinositide phosphatase, Sac1 (Burakov et al., 2008). Depletion of any one of these proteins leads to multipolar spindles and mitotic cell death. For example, RNAi-mediated knockdown of Sac1 resulted in disorganization of the Golgi apparatus and mitotic defects characterized by multiple mechanically active spindles (Liu et al., 2008). Similarly, loss of GRASP65 led to the formation of multipolar spindles and mitotic arrest followed by cell death (Sütterlin et al., 2005). The molecular mechanisms by which Golgi-associated proteins regulate spindle formation are not known. Also, it is not known whether Golgi components control spindle formation when Golgi membranes are in the form of a pericentriolar ribbon, isolated stacks, or small fragments.

Table II.

Golgi-associated proteins with a role in regulating centrosome and spindle function
ProteinFunctionDepletion phenotypeReference
Sac1Lipid phosphataseMultiple mechanically active spindlesLiu et al., 2008
GM130GolginAberrant centrosome, multipolar spindlesKodani and Sütterlin, 2008
GRASP65Golgi matrixMultipolar spindles, mitotic cell deathSütterlin et al., 2005
RINT-1Membrane trafficMultipolar spindles, mitotic cell deathSun et al., 2007
Tankyrase-1ADP ribosyl transferaseMultipolar spindles, mitotic cell deathChang et al., 2005
Rab6′GTPaseMetaphase block, SAC activationMiserey-Lenkei et al., 2006
ClathrinVesicle coatDefects in chromosome congression, SAC activationRoyle et al., 2005
Open in a separate windowSAC, spindle assembly checkpoint.In addition to Golgi-dependent effects on spindle formation, other mitotic events are also regulated by disassembly of Golgi stacks during prophase and prometaphase. Indeed, this disassembly step correlates with the release of several peripheral proteins from Golgi membranes to carry out specific functions during mitosis. For instance, clathrin dissociates from the Golgi complex and from endocytic vesicles during mitosis and localizes to the spindle pole where it stabilizes mitotic spindle fibers involved in chromosome segregation (Royle et al., 2005). The small GTPase, Rab6A′, is also released from the Golgi during mitotic Golgi fragmentation (Miserey-Lenkei et al., 2006). If this dynamic behavior of Rab6A′ is inhibited, cells are no longer able to progress through mitosis and are blocked in metaphase through activation of the spindle checkpoint. Another example is the Golgi-associated protein ACBD3, whose release and cytoplasmic dispersal during mitotic Golgi breakdown is necessary for the activation of Numb in the regulation of asymmetric cell division (Zhou et al., 2007). Thus, in addition to facilitating the partitioning of Golgi membranes into the daughter cells, Golgi fragmentation may provide a unique mechanism for the regulation of signaling pathways that involve Golgi-associated components. In the case of ACBD3 and Rab6A′, Golgi fragmentation may relieve inhibitory effects that are either the result of proximity with the centrosome or the organization of the Golgi ribbon.

Conclusions

There is increasing evidence that the relationship between the Golgi apparatus and the centrosome in mammalian cells extends beyond physical proximity and involves functional interactions. Several features of this Golgi–centrosome relationship can be surmised from the recent studies reviewed. This relationship appears to be bidirectional because components of each organelle are able to influence the function of the other organelle. For example, Golgi proteins are necessary for centrosome organization and positioning (Chang et al., 2005; Sütterlin et al., 2005; Kodani and Sütterlin, 2008), whereas centrosome-nucleated microtubules are required for pericentriolar Golgi positioning (Corthésy-Theulaz et al., 1992; Cole et al., 1996). Importantly, these functional interactions affect fundamental cellular processes such as cell polarization and progression through mitosis (Sütterlin et al., 2002; Yadav et al., 2009). Intriguingly, there is evidence for functional interactions when the Golgi and the centrosome are in physical proximity during interphase but also during mitosis when they are physically separate.What is the functional significance of the physical proximity between the Golgi and the centrosome? One possibility is that it may enhance the efficiency of signaling between the Golgi and centrosome and thereby facilitate directional protein transport. The Golgi apparatus is well known for its role in the exocytic pathway, and Golgi membranes, the intermediate compartment, and late endosomes are concentrated in the centrosomal area in mammalian cells (Marie et al., 2009). Thus, the centrosomal area may serve as a traffic hub, allowing integrated regulation of exocytic and endocytic transport routes for polarized delivery of cargo. In support of this idea, species in which Golgi membranes are not adjacent to the centrosome use alternative strategies for transporting proteins in a directional manner. For example, polarized secretion in Drosophila melanogaster is achieved by targeting mRNA to specific transitional ER–Golgi units in which the cargo is synthesized and secreted locally (Herpers and Rabouille, 2004).Why has it taken so long to reveal functional Golgi–centrosome interactions during cell division? The phenomenon of a pericentriolar interphase Golgi ribbon, which is fragmented and dispersed during mitosis, is mainly seen in mammalian cells. Therefore, the significance of this dynamic spatial relationship cannot be studied in a more genetically tractable system such as yeast or Drosophila in which genome-wide screens can be readily performed. Furthermore, there has been a lack of tools to separate the Golgi and centrosome without affecting the functions of these organelles. Some recent studies have used new approaches such as severing the Golgi ribbon by depleting structural golgins, but there are still experimental limitations. For example, an intact Golgi ribbon cannot simply be displaced from the pericentriolar region, which makes it difficult to directly test the significance of Golgi localization versus organization. In addition, Golgi fragmentation, as induced by the depletion of structural Golgi proteins, is a multifactorial process that is marked by both the loss of the Golgi ribbon and dispersal from the pericentriolar position. The limited availability of experimental tools makes it difficult to separate these processes, which has hampered efforts to dissect their individual contributions to the Golgi–centrosome partnership. Also, until a recent study (Kodani et al., 2009), a molecular pathway linking the Golgi and the centrosome during interphase had not been described. For these reasons, it has been difficult to experimentally alter Golgi–centrosome proximity and assay the effects.Although progress has been made, there are many unresolved questions about the Golgi–centrosome relationship during the cell cycle. For example, is there a single bidirectional regulatory pathway between the Golgi and the centrosome, or are there separate signaling pathways in each direction? Are there differences in signaling between these organelles during interphase when the organelles are adjacent and in mitosis when they are physically separate? There are also more specific unanswered questions. For example, how do Golgi proteins control spindle formation? Which factors on the mitotic spindle regulate postmitotic reassembly of the Golgi? How does the organization of the Golgi apparatus control progression through the cell cycle? Is there a Golgi organization checkpoint, and what does it monitor? The answers to these questions will help us better understand the significance of Golgi–centrosome interactions and could lead to the development of novel approaches for the treatment of several important diseases, including cancer.  相似文献   

19.
Monkey B Virus (Cercopithecine herpesvirus 1)     
David Elmore  Richard Eberle 《Comparative medicine》2008,58(1):11-21
  相似文献   

20.
The molecular evolution of function in the CFTR chloride channel     
Daniel T. Infield  Kerry M. Strickland  Amit Gaggar  Nael A. McCarty 《The Journal of general physiology》2021,153(12)
The ATP-binding cassette (ABC) transporter superfamily includes many proteins of clinical relevance, with genes expressed in all domains of life. Although most members use the energy of ATP binding and hydrolysis to accomplish the active import or export of various substrates across membranes, the cystic fibrosis transmembrane conductance regulator (CFTR) is the only known animal ABC transporter that functions primarily as an ion channel. Defects in CFTR, which is closely related to ABCC subfamily members that bear function as bona fide transporters, underlie the lethal genetic disease cystic fibrosis. This article seeks to integrate structural, functional, and genomic data to begin to answer the critical question of how the function of CFTR evolved to exhibit regulated channel activity. We highlight several examples wherein preexisting features in ABCC transporters were functionally leveraged as is, or altered by molecular evolution, to ultimately support channel function. This includes features that may underlie (1) construction of an anionic channel pore from an anionic substrate transport pathway, (2) establishment and tuning of phosphoregulation, and (3) optimization of channel function by specialized ligand–channel interactions. We also discuss how divergence and conservation may help elucidate the pharmacology of important CFTR modulators.

IntroductionThe ATP-binding cassette (ABC) transporter superfamily includes many members of clinical relevance, such as the multidrug resistance proteins (MRPs) and other proteins involved in generation of antibiotic resistance, transport of a wide variety of substrates in pathogenic bacteria, and transport of bile acids, lipids, and lipopolysaccharides (Ford and Beis, 2019; Jetter and Kullak-Ublick, 2020). ABC transporter genes encode the largest family of transmembrane (TM) proteins among living organisms (Briz et al., 2019) and are expressed in all domains of life (Ford and Beis, 2019; Holland et al., 2003). Either function or dysfunction of ABC transporters is implicated in development or treatment of cancer (Briz et al., 2019; Nobili et al., 2020), neurological disorders (Jha et al., 2019; Sumirtanurdin et al., 2019), detoxification (Briz et al., 2019), visual function (Garces et al., 2018), and, among many other clinical presentations (Moitra and Dean, 2011), in cystic fibrosis (CF; Riordan et al., 1989). In CF, mutations in the gene encoding CFTR lead to loss of anion transport in a wide variety of epithelial tissues (Csanády et al., 2019). In this review, we use the data generated from >30 yr of intensive structure-function study of CFTR and related proteins to propose and evaluate a potential route by which CFTR may have evolved unique function as a phosphorylation-regulated chloride channel. New insights are made possible by the advent of high-resolution cryo-EM structures of CFTR and the recent cloning and characterization of the evolutionarily oldest known orthologue of CFTR, from sea lamprey (Lp-CFTR; see below), which exhibits many functional differences from the human CFTR orthologue (hCFTR; Cui et al., 2019a).Overview of CFTRCFTR is a Cl/HCO3 channel whose dysfunction directly leads to CF, the most common life-shortening genetic disease among Caucasians, affecting ∼80,000 individuals worldwide (Riordan et al., 1989; https://cftr2.org/mutations_history). The role of CFTR has been well characterized in airway, intestine, and sweat gland epithelial cells (Buchwald et al., 1991; Gonska et al., 2009; Haq et al., 2016; Quinton et al., 2012; Quinton, 2007; Trezíse and Buchwald, 1991), where the anionic flux mediated by the protein contributes to water secretion and regulation of pH (Pezzulo et al., 2012; Rowe et al., 2014). CFTR also functions in several nonepithelial cell types (Cook et al., 2016; Edlund et al., 2014; Gao and Su, 2015; Guo et al., 2014; Norez et al., 2014; Pohl et al., 2014; Schulz and Tümmler, 2016; Su et al., 2011), including in the brain (Ballerini et al., 2002; Guo et al., 2009; Hincke et al., 1995; Johannesson et al., 1997; Mulberg et al., 1995; Mulberg et al., 1998; Parkerson and Sontheimer, 2004; Pfister et al., 2015; Plog et al., 2010; Weyler et al., 1999). Several hundred disease-causing mutations have been identified in the CFTR gene. For a subset of these mutations, four small-molecule modulator therapeutics from Vertex Pharmaceuticals, Inc. that increase the surface expression or activity of CFTR have been approved for clinical use. The first approved drug, VX-770 (ivacaftor), is a gating potentiator that increases function of certain CFTR mutants (Cui et al., 2019b; Sosnay et al., 2013; Van Goor et al., 2009; Van Goor et al., 2014; Yu et al., 2012). A better understanding of these drugs and their binding sites may aid in refining the next class of therapeutics.ABC transporters use the energy of ATP binding and hydrolysis to accomplish the active import or export of various substrates across membranes (Rees et al., 2009). There are seven subfamilies of mammalian ABC transporters (ABCA, ABCB, ABCC,… ABCG), of which the E and F subfamilies do not bear actual transport function (Dean et al., 2001; Ford and Beis, 2019). A new classification of the ABC transporter superfamily that is based on the transmembrane domain (TMD) fold has recently been suggested (Thomas et al., 2020). CFTR is denoted ABCC7 and a member of type IV, respectively, according to these two classification schemes. CFTR bears ATPase activity like that of other ABCC subfamily members (Li et al., 1996; Stratford et al., 2007; Jordan et al., 2008), but biophysical methods have firmly established that CFTR functions as a phosphorylation-activated and ATP-gated ion channel (Anderson et al., 1991a; Anderson et al., 1991b; Bear et al., 1992; Berger et al., 1991; Sheppard et al., 1993), whereas its closest ABCC relatives function as multispecific exporters of organic anions (Jordan et al., 2008). CFTR may directly mediate the flux of glutathione (Gao et al., 1999; Kogan et al., 2003; Linsdell and Hanrahan, 1998), although CFTR-mediated active transport has not been shown, to our knowledge. Glutathione is transported by close ABCC relatives ABCC1/MRP1 (Mao et al., 1999) and ABCC4/MRP4 (Choi et al., 2001; Ko et al., 2002; Kogan et al., 2003; Ritter et al., 2005; Serrano et al., 2006); previous analysis has identified ABCC4 as CFTR’s closest relative (Jordan et al., 2008; see also Cui et al., 2019a). The domain organization of CFTR is similar to that of its closest relatives, the “short transporters” of the ABCC subfamily (Jordan et al., 2008; Ford and Beis, 2019; Srikant and Gaudet, 2019), with two nucleotide-binding domains (NBDs) that function in ATP binding and hydrolysis, and two TMDs, each containing six TM helices that comprise the substrate transport pathway (Fig. 1). However, unique to CFTR is an intracellular regulatory (R) domain that contains multiple consensus sites for phosphorylation by PKA (Sebastian et al., 2013).Open in a separate windowFigure 1.Domain architecture of CFTR. (A) Five functional domains: TMD1, NBD1, R domain with multiple phosphorylation sites, TMD2, and NBD2. Each TMD includes six transmembrane helices, numbered 1–12. The N-terminus includes the lasso motif (shown in pink), whereas the C-terminus includes a PDZ binding domain motif (yellow). (B) hCFTR from cryo-EM structure (PDB accession no. 6MSM). The R domain is not shown, because it is intrinsically unstructured.The opening of CFTR may be simplified to involve three sequential steps that have been uncovered via a combination of functional and structural data. First, PKA binds to (Mihályi et al., 2020) and phosphorylates (Rich et al., 1991) the aforementioned R domain, which results in loss of inhibitory interactions between that domain and the rest of the channel protein. Second, ATP binds to two sites at the interface of the cytoplasmic NBDs, which promotes a stable NBD dimer (Mense et al., 2006; Vergani et al., 2005). Finally, the wave of conformational changes associated with ATP-induced dimerization of the NBDs is transmitted to the pore domain, resulting in pore opening (Rahman et al., 2013; Simhaev et al., 2017; Sorum et al., 2015; Strickland et al., 2019). In related ABC exporters, ATP-dependent dimerization of the NBDs drives an overall transition from inward- to outward-facing conformation of the TMDs; this function was coopted by CFTR to drive ATP-induced channel opening (Fig. 2). At the level of individual residues, there is high conservation with transporters among amino acids in CFTR that are proposed to stabilize the inward-facing (closed) conformation in the absence of ATP (Wang et al., 2010; Wei et al., 2014; Wei et al., 2016), suggesting conservation of motifs integral to energetic signaling (Wang et al., 2014b; Wei et al., 2014; Wei et al., 2016). The close proximity of intracellular loops 2 and 4 (ICL2 and ICL4, respectively; Doshi et al., 2013; Wang et al., 2014b), constriction of the intracellular vestibule (Bai et al., 2011), and dilation of the extracellular vestibule, relative to the closed state, are all associated with channel opening (Beck et al., 2008; Infield et al., 2016; Norimatsu et al., 2012b; Rahman et al., 2013; Strickland et al., 2019). The CFTR pore opens in stages, requiring the sequential breaking and forming of intraprotein residue–residue interactions (Cui et al., 2013, 2014; Rahman et al., 2013), resulting in two subconductance states in addition to the full-conductance state (Gunderson and Kopito, 1995; Zhang et al., 2005a; Zhang et al., 2005b; Fig. 3). Using a particularly informative cysteine mutant at the outer vestibule, R334C-CFTR, the McCarty laboratory found that transitions between these subconductance states are highly dependent upon experimental conditions; for example, closing transitions almost always start from the s2 state in the presence of ATP, and transitions from s2 to f never occur in channels bound with the poorly hydrolyzable ATP analogue AMP-PNP (see also Langron et al., 2018), suggesting that this transition requires hydrolysis of nucleotide at the NBDs (Zhang et al., 2005a; Zhang et al., 2005b). Subconductance states are evident in recordings of WT CFTR from membrane patches and planar lipid bilayers, depending on experimental conditions, indicating that these represent inherent steps in gating of the channel pore (Gunderson and Kopito, 1995). In WT-hCFTR, this open pore is quite stable and does not close until ATP is hydrolyzed at the NBDs (Baukrowitz et al., 1994). Note that because CFTR displays three types of gating in one channel (phosphorylation-mediated, ligand-mediated, and pore-mediated gating), it serves as an exemplary target for studying the evolution of functional mechanisms within a single membrane protein.Open in a separate windowFigure 2.Hypothesis for emergence of channel function in CFTR. Modification of ATP-dependent transport activity in ABC transporters led to channel behavior, coopting the conformational changes necessary for unidirectional substrate transport in common ABC transporter systems. CFTR evolved features that break the alternating access cycle (solid-line arrows), enabling it to be open at both ends (box). Color scheme for major domains (again, lacking the R domain) is the same as in Fig. 1.Open in a separate windowFigure 3.Gating scheme for CFTR. Prephosphorylated channels are shown in the membrane (gray slab) with two TMDs (brown and dark blue) and two NBDs (green and light blue), with ATP (red circle) and ADP (yellow circle). ATP-dependent gating is shown as including NBD-mediated gating steps leading to pore gating between conductance levels. Here, we do not distinguish between s1 and s2 subconductance levels, because s1→s2 occurs very rapidly in WT-hCFTR.Natural history of the CFTR channel in vertebratesGiven the structural conservation among CFTR and ABC exporters noted above, and functional conservation in terms of ATP dependence, how CFTR evolved to function as an anion channel regulating passive ionic diffusion has been an enduring question (Srikant, 2020; Srikant et al., 2020). Molecular evolution studies are facilitated by the availability of many orthologues for the protein/gene of interest, spanning as much of the evolutionary record as possible. Currently, ∼300 CFTR orthologues are included in GenBank/UniProt, although not all of these are represented by expressible cDNA clones. Until very recently, the oldest CFTR orthologue known was from the dogfish shark, arising ∼150 million yr ago (MYA; Fig. 4; Marshall et al., 1991); this orthologue bears functional characteristics similar to those of hCFTR. However, reasoning that the identification of an earlier CFTR orthologue with altered structure/function would provide novel insight into the evolution of epithelial anion transport, the Gaggar and McCarty laboratories recently led an effort to clone and characterize the Lp-CFTR (Cui et al., 2019a), which arose ∼550 MYA (Smith et al., 2013). The identification of a CFTR orthologue in the jawless vertebrates establishes that CFTR exists across all vertebrates, predating the divergence of jawed and jawless vertebrates at the end of the Cambrian Period ∼488 MYA. Sequence analysis indicates 46% sequence identity and 65% sequence similarity between Lp-CFTR and hCFTR, which is much lower than that among jawed vertebrate CFTRs (jv-CFTRs) and includes surprising divergence in functionally relevant motifs. Accordingly, Lp-CFTR differs from hCFTR in multiple functional characteristics (Fig. 4). Thus, it cannot be automatically assumed that every position in CFTR that is unique in sea lamprey represents transitional change in the development of regulated channel activity. A good example in this regard is that of F508 in hCFTR, which is conserved across multiple ABC proteins but is leucine in lamprey (Cui et al., 2019a). Sorum et al. (2017) showed that replacing F508 with L in hCFTR significantly reduced its open probability. All known CFTRs other than Lp-CFTR and all known human ABCCs have F at this position, where the aromatic side chain is necessary for stabilizing the outward-facing state (Cui et al., 2006), so finding that this is substituted by a nonaromatic side chain in Lp-CFTR is mechanistically interesting and may represent a species-specific adaptation (Cui et al., 2019a).Open in a separate windowFigure 4.Simplified and truncated evolutionary tree for vertebrates. Green, common vertebrate ancestor; blue, jawless vertebrates; red and yellow, jawed vertebrates; yellow, mammals. CFTR orthologues studied in functional assays are shown underlined. (The time domain in this figure is not implied.)Table 1.Comparison of features between human and lamprey orthologues, focusing on three major domains of function: channel behavior, regulation, and modulation
Lp-CFTRhCFTR
Functional domain: channel behavior
Open channel stability (open burst duration)LowHigh
Frequency of subconductance statesHighLow
Single-channel open conductanceLowHigh
Shape of I-V relationshipRectifiedLinear
Sensitivity to (affinity for) ATP for channel openingVery lowHigh
Functional domain: regulation by phosphorylation
Rate of activation by PKA-mediated phosphorylationLowHigh
Number of predicted PKA sites in the R domain48
Functional domain: pharmacological modulation
Effect of VX-770/ivacaftor (inhibition versus potentiation)Small inhibitionPotentiation
Inhibition by CFTRinh172LowHigh
Sensitivity to pore block by GlyH-101NoneHigh
Sensitivity to pore block by NPPBLowHigh
Sensitivity to pore block by glibenclamideEqualEqual
Open in a separate windowNPPB, 5-nitro-2-(3-phenyl-propylamino) benzoic acid. Related to Cui et al., 2019a.Below, we identify several potential routes by which CFTR evolved regulated channel behavior. We propose that many features shared among bona fide ABCC proteins and present in recent ABCC ancestors of CFTR provided a unique opportunity for emergence of novel channel function by incremental evolutionary changes.Molecular evolution of channel functionConstruction of an anionic pore from an anionic substrate pathwayBoth the passive conduction of anions by CFTR and the unidirectional transport of highly structurally diverse organic anions by its ABCC relatives (Sauna et al., 2004) is accomplished by pathways through the TMDs. Therefore, divergence in these pathways would be expected to most closely reflect the principal difference between channels and transporters: channels contain a pore that allows uninterrupted permeation across the plasma membrane, a violation of the “alternating access” mechanism of transporters (Fig. 2; Bai et al., 2011; Gadsby, 2009). This divergence would be accomplished by evolutionary changes distributed broadly through the TMDs, as suggested by a recent study of mutations that alter substrate specificity in a fungal pheromone transporter (Srikant and Gaudet, 2019; Srikant et al., 2020). In formation of the CFTR chloride channel, this would require both degradation of the “gates” seen in ABC transporters and stabilization of an open pore conformation (Bai et al., 2011). The relationship between substrate binding and opening/closure of these gates, relevant to establishing the occluded state in transporters, may remain in CFTR in a vestigial state, as evidenced by reports that permeating anions may affect gating transitions (Sorum et al., 2015; Yeh et al., 2015; Zhang et al., 2000; Zhang et al., 2002).Understanding how the CFTR pore evolved requires the integration of functional and structural information. Early 2-D electron crystallography of hCFTR at low resolution (Rosenberg et al., 2004; Rosenberg et al., 2011) confirmed the general ABC-like architecture of CFTR predicted in the initial gene discovery study (Riordan et al., 1989). In addition, several homology models of CFTR were developed using structures of related ABC transporters as a template. These studies contributed to the understanding of the molecular interface encompassing the most common CF-causing mutation (ΔF508; Mornon et al., 2008; Serohijos et al., 2008), as well as several details relating to the conformational transitions underlying CFTR gating (Corradi et al., 2015; Dalton et al., 2012; Furukawa-Hagiya et al., 2013; Mornon et al., 2015; Mornon et al., 2009; Rahman et al., 2013; Strickland et al., 2019). However, the disparity between the wide variety of substrates of nonchannel ABC transporters and the chloride channel function of CFTR resulted in intrinsically limited confidence in these homology models, at least with respect to the TMDs.In the last 5 yr, eight structures of detergent-solubilized CFTR from three orthologues have been released from two laboratories in a large range of resolutions, all solved by single-particle cryo-EM (Fig. 5).Table 2.High-resolution CFTR structures to date
ProteinzfCFTRhCFTRzfCFTRhCFTRhCFTRhCFTRchCFTRchCFTR
OrthologueZebrafishHumanZebrafishHumanHumanHumanChickenChicken
Resolution3.7 Å3.9 Å3.4 Å3.2 Å3.3 Å3.2 Å4.3 Å6.6 Å
DetergentDetergent (LMNG, digitonin, CHS)Detergent (LMNG, digitonin, CHS)Detergent (LMNG, digitonin, CHS)Detergent (LMNG, digitonin, CHS)Detergent (LMNG, digitonin, CHS)Detergent (LMNG, digitonin, CHS)Detergent (DMNG, digitonin)Detergent (DMNG, digitonin)
MutationE1372QE1371QE1371QE1371QΔRI/1404S/1441XΔRI/1404S/1441X
StateClosed, inward facing, dephosphorylated, apo-ATPClosed, inward facing, dephosphorylated, apo-ATPClosed, outward facing, phosphorylated, ATP-boundClosed, outward facing, Phosphorylated, ATP-boundClosed, outward facing, Phosphorylated, ATP-bound, VX-770-boundClosed, outward facing, Phosphorylated, ATP-bound, GLPG1837-boundClosed, inward facing, dephosphorylated, ATP-presentClosed, inward facing, phosphorylated, ATP-present
PDB accession no. 5UAR 5UAK 5W81 6MSM 6O2P 6O1V 6D3R 6D3S
Year20162017201720182019201920182018
Open in a separate windowch, chicken; CHS, cholesteryl hemisuccinate; DMNG, decyl maltose neopentyl glycol; LMNG, lauryl maltose neopentyl glycol; zf, zebrafish.Open in a separate windowFigure 5.High-resolution structures of CFTR. See Liu et al., 2017; Zhang and Chen, 2016). Subsequently, the structures of phosphorylated, ATP-bound, hydrolysis-deficient mutants of zfCFTR and hCFTR in the outward-facing state were resolved at reported resolutions of 3.4 Å and 3.2 Å, respectively (Zhang et al., 2017; Zhang et al., 2018). In addition to revealing a structural motif unsuspected for CFTR—the lasso motif found in other ABCC transporters (e.g., SUR1, SUR2, MRP1) in which the N-terminus loops into the lipid bilayer (Fig. 1 A)—these CFTR structures exhibited TM helix positioning and secondary structure that may be unique to CFTR among the ABCs. Of note, TM7 and TM8 are rearranged such that the top-down TM helix symmetry of most ABC transporters is broken. There are also kinks in TM8 and TM5 helices in approximately the same vertical position. We note that two structures from recombinant thermostabilized chicken CFTR (chCFTR), one in dephosphorylated conditions with ATP present (resolution, 4.3 Å) and one in phosphorylated conditions with ATP present (resolution, 6.6 Å), show TM8 as fully helical and lack the rearrangement of TM7 and TM8, instead positioning TM7 nearly orthogonal to the fatty acid tails of the lipid bilayer (see Fig. 5; Fay et al., 2018).The positioning of TM8 in the Chen structures has been supported by functional evidence suggesting that some residues of TM8 line the CFTR channel pore (Negoda et al., 2019). The unwound portion of TM8 has been proposed by the Chen laboratory to underlie CFTR’s unique channel function (Liu et al., 2017), and molecular dynamics studies suggest that this unwinding would be maintained in a lipid bilayer (Corradi et al., 2018). The stability of this segment may be enhanced by interactions between R933, located at the intracellular boundary of the unwound portion of TM8, and E873, in TM7. In both the structures of closed hCFTR (Protein Data Bank [PDB] accession no. 5UAK) and nearly open hCFTR with ATP bound (PDB accession no. 6MSM), the oppositely charged ends of these residues essentially overlap. It is very interesting to note that R933 is conserved within CFTR and ABCC4 orthologues among both jawed and jawless vertebrates. However, E873 is conserved within jawed vertebrates but is Q in both Lp-CFTR and all ABCC4s, although this assignment must remain tentative due to the poor alignment between CFTR and ABCC4 sequences in TM7. Within the unwound stretch of TM8 itself, sequences are poorly conserved even within the CFTR and ABCC4 branches.Importantly, an open structure of CFTR with a fully conducting ion pore has yet to be published. Currently, all structures have been determined with CFTR in detergent; additional structures of CFTR in a lipidic environment may be needed to elucidate the fully conducting ion pathway as well as to understand the complex conformational transitions between open and closed states. Regardless of these considerations, these structures can certainly be used to spatially locate amino acids that have been implicated in CFTR channel function. In aid of this, significant effort has been expended to functionally map the chloride conduction pathway through CFTR. Many studies have mutated putative pore residues and characterized channel behavior and modulation (Linsdell et al., 1997; McCarty et al., 1993; McDonough et al., 1994; Tabcharani et al., 1997). To identify explicitly “pore-lining” residues, several groups have employed the substituted cysteine accessibility method. This approach probes the environment of specific residues by mutating them to cysteine and characterizing their reaction to sulfhydryl-specific chemicals (Karlin and Akabas, 1998).In the process of going through the channel to exit the cell, the chloride ion first encounters highly conserved basic residues in the ICLs, including K190, R248, R303, K370, R1030, K1041, and R1048. These residues are proposed to play roles in attracting chloride ions into the pore because charge-eliminating mutations reduce single-channel conductance (Aubin and Linsdell, 2006; El Hiani and Linsdell, 2015; Zhou et al., 2008). Considering that they mediate anion conduction, it is initially surprising that this group of residues is very highly conserved in transporter ABCCs: all seven residues analogous to those listed above are basic in ABCC4 and most (five of seven) are basic in ABCC5. To our knowledge, the effect of mutations at these positions on the function of ABCC4 or ABCC5 has not been directly tested. However, functional studies of MRP1 (ABCC1) have specifically implicated several basic residues in analogous regions in the binding of organic anionic substrates (Conseil et al., 2006; Haimeur et al., 2004) that are transported by the majority of ABCCs, including ABCC4 and ABCC5 (Jansen et al., 2015; Ritter et al., 2005). These data are intriguing because they suggest that one way in which CFTR evolved chloride channel activity was to use residues already functionally important in the transport of organic anionic substrates and repurpose them toward the novel function of conducting inorganic anions through the channel pore. In further support of this, several substrates of ABCC transporters inhibit CFTR by blocking the pore from the intracellular side (Linsdell and Hanrahan, 1999). Hence, these residues may contribute to a vestigial binding site for these substrates within CFTR. Another intriguing possibility is that ABCC4 and ABCC5 may allow the conductance of chloride along with their traditional substrates during transport, in a manner akin to the leak current associated with the function of neurotransmitter transporters (Fairman et al., 1995; Sonders and Amara, 1996; Wadiche et al., 1995). Such a substrate-induced current has not yet been measured from cells expressing ABCC4 or ABCC5, although this would be expected to be of very low amplitude (due to the slower nature of transporter function) and would likely be challenging to measure because substrate binds intracellularly in these proteins.As the chloride ion travels further up the CFTR pore toward the extracellular space, it encounters pore-lining residues contributed by TM helices 1, 5, 6, 8, 9, 11, and 12 (Alexander et al., 2009; Bai et al., 2010; Bai et al., 2011; Gao et al., 2013; McDonough et al., 1994; Wang et al., 2014a; Zhang and Hwang, 2015; Zhang et al., 2005b; Zhang et al., 2002). Fig. 6 A shows the nearly open structure of hCFTR, wherein we have highlighted residues shown by the substituted cysteine accessibility method to line the pore (Akabas, 1998; Alexander et al., 2009; Aubin and Linsdell, 2006; Bai et al., 2010; Bai et al., 2011; El Hiani and Linsdell, 2015; El Hiani et al., 2016; Fatehi and Linsdell, 2009; Gao et al., 2013; Liu et al., 2004; Negoda et al., 2019; Norimatsu et al., 2012a; Norimatsu et al., 2012b; Qian et al., 2011; Rubaiy and Linsdell, 2015; Serrano et al., 2006; Wang et al., 2011; Wang et al., 2014a; Zhang and Hwang, 2015; Zhou et al., 2008). Residues are colored according to conservation between CFTR and ABCC4 (Jordan et al., 2008; dark blue, conserved; black, similar; magenta, divergent).Open in a separate windowFigure 6.Conservation with ABCC4 in residues lining the CFTR channel pore. (A) hCFTR structure (PDB accession no. 6MSM) in nearly open state, showing major domains, with sections of non–pore-lining helices removed in order to visualize the chloride ion permeation pathway. Dark blue residues, identical between jawed vertebrate consensus CFTR and ABCC4; black residues, biochemically similar; magenta, biochemically divergent. The highly divergent pore-lining TM6 is bounded in red. (B) hCFTR (PDB accession no. 6MSM) is again shown, highlighting a lateral portal proposed to enable unique chloride channel activity among ABCCs. Inset is a closeup view of a kink in TM6. P355 is conserved with ABCC4, whereas R352 and Q353 are divergent.Strikingly, the pore-lining residues of several TMs are highly conserved between CFTR and ABCC4; for example, in TM1, six of seven pore-lining residues in CFTR are identical in ABCC4. Regarding this conservation, TM6 (see region bounded in red in Fig. 6) is an outlier, both in terms of the number of biochemically divergent pore-lining residues and as calculated as a sum of the Grantham scores (incorporating differences in composition, polarity, and molecular volume; Grantham, 1974) to gauge evolutionary distance between consensus amino acids of CFTR and ABCC4 sequences from jawed vertebrates (Alexander et al., 2009; Bai et al., 2010; Norimatsu et al., 2012a), whereas residues F337 through V345 exhibit a helical pattern of modification by MTS reagents applied intracellularly (Bai et al., 2010; El Hiani and Linsdell, 2010). This also contrasts with better-conserved helices such as TM1 and TM11, wherein reactivity follows a helical periodicity (RegionResidue numbersAggregate Grantham scoreaTM192, 95, 98, 102, 106, 107, 109111ICL1186, 188, 189, 190,32TM3191, 192, 193, 194, 195, 196, 197, 199, 200, 203, 205, 207, 211, 213, 215532ICL2241, 243, 244, 248, 252, 299, 303,142TM5306, 307, 310, 311, 326209TM6331, 333, 334, 335, 336, 337, 338, 339, 340, 341, 342, 344, 345, 348, 349, 352, 353, 355, 356, 360, 367, 3701,389TM8913, 914, 917327ICL3 986, 988, 989, 990 0TM9993, 1000, 1003, 1008, 1009, 1010361ICL4 1030, 1041, 1048 0TM111112, 1115, 111858TM121127, 1129, 1131, 1132, 1134, 1135, 1137, 1138, 1139, 1140, 1141, 1142, 1144, 1145, 1147, 1148, 1150, 1152, 1156561Open in a separate window Italics = identical; underlined = divergent; unformatted = similar.aA higher Grantham score indicates less conservation.Divergence in TM6, a highly discriminatory region of the CFTR pore (McCarty and Zhang, 2001), may play important roles in neofunctionalization toward channel activity while retaining glutathione transport capacity (Kogan et al., 2003). Divergent residues such as R334 in TM6 also play important enough roles in the electrostatic attraction of Cl and in pore stability (Zhang et al., 2005b) that their mutation causes CF (Sheppard et al., 1993).How may this divergence be responsible for the structural changes necessary for the development of ion channel activity? First, divergence in TM6 may play a central role in the degradation of an intracellular transporter gate. In the human and zebrafish ATP-bound CFTR cryo-EM structures (PDB accession nos. 6M2M and 5W81), the intracellular region of TM6 is subtly kinked outward (Fig. 6 B), as opposed to being curved but tightly packed in ABCC1, the closest relative to CFTR for which a structure exists. It has been proposed that this change may have created an aqueous “portal” that contributes to the ion permeation pathway (Zhang et al., 2017). Both functional and structural studies support the importance of these changes (El Hiani and Linsdell, 2015; El Hiani et al., 2016; Li et al., 2018; Zhang et al., 2017). Sequence comparisons in this region reveal that a proline was already present in this region in an ancestral ABCC. In the place of conserved hydrophobic residues in ABCC4, CFTR has hydrophilic residues in this region, including R352 and Q353. These residue changes may be responsible for fundamentally altering the interaction of TM6 with surrounding helices, ultimately contributing to the degradation of the intracellular gate. Notably, the Lp-CFTR sequence uniquely contains a serine residue analogous to position 353.Second, divergence in the TMDs also apparently enabled the formation of several intraprotein interactions that stabilize the open CFTR pore, which would be antithetical to the rapid transitions in conformation of the substrate binding pocket in a transporter undergoing alternating access. Previously, to identify important loci of divergence between CFTR and transporters of the ABCC subfamily, the McCarty laboratory performed type II divergence analysis between CFTR and ABCC4 sequences (Jordan et al., 2008). This approach identified residues maximally conserved within groups and biochemically divergent between groups. Type II divergence is exemplified by residue positions within an alignment that (1) are completely conserved within paralogous groups and (2) have amino acids with biochemically different properties between paralogous groups (e.g., acidic charge versus basic charge; Gu, 1999; Gu, 2001). The concept as applied here is that use of type II divergence analysis would identify the specific domains and residues most likely to be involved in the evolutionary transition from transporter activity (ABCC4) to channel activity (CFTR). In this study, we found that two salt bridges (Fig. 7) that stabilize the open pore architecture of CFTR (R347-D924 [Cotten and Welsh, 1999] and R352-D993 [Cui et al., 2008]) consist of one residue that is highly conserved between CFTR and ABCC4 (R347 in TM6 and D993 in TM9) and one that is type II divergent (D924 in TM8 and R352 in TM6). Interestingly, both interactions include residues mutated in CF disease (Jordan et al., 2008). Here we note that in both of these salt bridge interactions, the residue biochemically conserved between CFTR and ABCC4 is divergent in ABCC5. Thus, in each pair, the first residue likely emerged in a common ancestor of CFTR and ABCC4 after divergence from ABCC5, thereby providing the basis of a salt bridge when the other residue subsequently emerged in CFTR (Fig. 7). For the R352-D993 pair, the evolution of R352 from divergent hydrophobic residues in the ancestors was highly adventitious because it appears to have simultaneously contributed to the formation of a pore-stabilizing salt bridge and the destabilization of the secondary structure of TM6 that potentially contributed to a cytoplasmic gate (see above). Similar evolutionary pathways may have been at play with interactions involving charged residues in extracellular loop 1, such as R117 (Cui et al., 2014). Of these, it is notable that R117 is not found in Lp-CFTR, where it is instead a hydrophobic residue as in ABCC4 and ABCC5. Thus, it is likely that additional residues, such as R117, emerged late in evolution to stabilize the pore in jv-CFTR. The existence of high-resolution structures for hCFTR in closed and nearly open states will facilitate the identification of other intraprotein interactions and allow us to ask whether these residues exhibit evolutionary patterns across species. Testing of the above will require structural and functional interrogation of CFTR transporter chimeras.Open in a separate windowFigure 7.Evolution of pore-stabilizing salt bridges absolutely conserved in CFTRs from jawed vertebrates, including hCFTR. For the two intraprotein salt bridges included here, as examples, one can trace the appearance of residue–residue interactions, and their fixation as conserved features, in the evolutionary lineage from ABCC5 and ABCC4 transporters to Lp-CFTR and jv-CFTR.Evolution of CFTR regulation by phosphorylation of its R domainCFTR is activated by PKA-mediated phosphorylation at consensus sites in the R domain representing a functional linker encoded between NBD1 and TMD2 (Fig. 1; Ford et al., 2020; Hunt et al., 2013). The structural mechanism for the phosphorylation-mediated regulation of CFTR by this intrinsically disordered domain is poorly understood but evidently involves dynamic, phosphosensitive interactions between R domain helices and nearby domains of CFTR, including NBD1 and NBD2 (Baker et al., 2007; Bozoky et al., 2013a; Bozoky et al., 2013b; Chappe et al., 2005). The R domain also has been suggested to plug the channel pore in a phosphorylation-dependent manner (Meng et al., 2019). Interestingly, although the fully dephosphorylated R domain precludes ATP-induced channel opening (Rich et al., 1991), biophysical studies strongly suggest that channel activity depends on the degree of PKA-mediated phosphorylation, in a rheostat-like manner, and that these sites play specific roles in “graded” activation of the channel (Csanády et al., 2005a; Csanády et al., 2000; Csanady et al., 2005b; Wilkinson et al., 1997). The phosphorylation of ABC proteins other than CFTR has not been extensively studied; however, there is some evidence that several members of the superfamily, including P-glycoprotein (ABCB1; Mellado and Horwitz, 1987), are phosphorylated in cells (see Stolarczyk et al., 2011 for a comprehensive review on this subject). There is evidence that several ABCB and ABCC proteins are phosphorylated in a region connecting NBD1 and TMD2 (Ford et al., 2020; Mellado and Horwitz, 1987; Stolarczyk et al., 2011). However, there is no clear evidence that mutation or phosphorylation of this region significantly affects the function of these transporters, as it profoundly does in CFTR (Stolarczyk et al., 2011). Moreover, the relevant PKA consensus sites in CFTR’s R domain are located in an ∼200-aa region that is absent in other ABC transporters (including other ABCCs; Sebastian et al., 2013). Based on data available at the time, the McCarty and Jordan laboratory suggested that this region arose in CFTR specifically as the result of the loss of an RNA splice site at the end of exon 14 in the lineage between jawless and jawed vertebrates (Sebastian et al., 2013). However, revised sea lamprey gene assemblies (see https://genomes.stowers.org/organism/Petromyzon/marinus and Smith et al., 2018) no longer indicate this splice junction, which explains the presence of an R domain in the cloned sea lamprey sequence (Cui et al., 2019a).The unique functional phosphoregulation of CFTR by the R domain may directly relate to its identity as the sole ion channel in the ABC superfamily. In the case of many bona fide ABC transporters, the activity of the protein, including hydrolysis of ATP (Senior et al., 1998), is highly dependent on the availability of substrates. These substrates, which include xenobiotics (Chen and Tiwari, 2011), are typically present at low concentrations in the cell, resulting in low transporter-associated ATPase activity. By contrast, CFTR always has access to chloride, and binding of chloride is not required for ATPase activity in the same way that binding of substrate is required for ATPase activity in other ABC superfamily members. Because ATP is present in the cell at concentrations well above the half-maximal effective concentration for channel opening (Csanády et al., 2000), without some other means of regulation, CFTR would allow unproductive high ATPase rates and the uninterrupted flow of chloride down the electrochemical gradient—in either direction with respect to the cell. By coupling the R domain–mediated regulation of the channel to PKA-mediated phosphorylation, the CFTR-expressing epithelial cell ensures that chloride is brought to the appropriate electrochemical potential by the coordinated action of basolateral chloride transporters, which are also regulated by PKA (McCann and Welsh, 1990), and CFTR-mediated permeability in the apical membrane.The overall sequence of the R domain is poorly conserved across CFTR orthologues, but the PKA consensus sites shown to be functionally relevant in hCFTR are highly conserved across jv-CFTRs (Sebastian et al., 2013). However, half of the consensus dibasic PKA sites are missing in Lp-CFTR (Fig. 8); furthermore, some of those that are found in both human and lamprey orthologues exhibit substantial divergence in the context surrounding the phosphorylated serine, which may contribute to differences in the rate of phosphorylation or to changes in conformation after phosphorylation. This is consistent with the observation that Lp-CFTR exhibits a greatly slowed response to PKA-induced activation (Cui et al., 2019a). The additional sites may have evolved in jv-CFTRs, after the split from jawless vertebrates, as a means of fine-tuning the graded activation intrinsic to hCFTR. Future work may explore the functional effects of transplantation of PKA recognition motifs and surrounding primary sequence from hCFTR into Lp-CFTR.Open in a separate windowFigure 8.Conservation among CFTR orthologues in PKA consensus sites in the R domain. Primary sequences equivalent to each of the eight consensus sites for PKA-mediated phosphorylation found in hCFTR are shown for mouse, chicken, frog, shark, and lamprey. Numbering for consensus sites at the top of the table refers to the hCFTR orthologue. Residues bearing divergence from the consensus dibasic sequence are shown in bold and underlined. Other variability in the primary sequence surrounding the target serine also is evident, which may contribute to altered response to phosphorylation.An inherited ATPase defect intrinsic to CFTR NBD-mediated gating kineticsIn ABC transporters, ATP binds at two composite sites (ABS1 and ABS2) formed by conserved motifs from NBDs positioned in a head-to-tail arrangement (Smith et al., 2002). Fig. 9 A depicts a simplified model of these sites, wherein each ABS is shown to consist of the so-termed Walker A, Walker B, and H loop regions from one NBD and the ABC signature and D loops from the other NBD. ATP binding to an ABS promotes NBD dimerization, which “powers” active transport by driving conformational changes in the TMDs (Rahman et al., 2013; Strickland et al., 2019); in ABC exporters, this flips the TMD conformation from inward to outward facing (Rees et al., 2009). ATP hydrolysis at these sites leads to dissociation of the NBD dimer, which allows the readoption of the inward-facing conformation to bind new intracellular substrates, although there is significant disagreement regarding the degree of dissociation undergone at the NBDs to accomplish this (George and Jones, 2012; Hohl et al., 2014; Puljung, 2015; Zoghbi et al., 2012). Structural (Zhang et al., 2017) and functional (Chaves and Gadsby, 2015) studies support the idea that CFTR uses the same overall scheme, wherein opening involves binding of ATP to both ABSs and dimerization of the NBDs, whereas closing results from ATP hydrolysis, which promotes the subsequent dedimerization of the NBDs.Open in a separate windowFigure 9.Evolutionary divergence within the NBD1–NBD2 interface. (A) Schematic representation of a prototypical head-to-tail NBD dimer sandwich and the interfacial regions that interact with ATP. (B) Alignment of several relevant regions of the NBDs from CFTR and more distant homologues. Numbering is of hCFTR NBD1. Note that jv-CFTR represents the consensus sequence from CFTR from jawed vertebrates, whereas Lp-CFTR specifically refers to the sequence of Lp-CFTR. Significant ABCC- and CFTR-specific divergence is seen in ABS1, particularly in the NBD2 signature sequence, the NBD1 Walker B motif, and the NBD1 His region. To facilitate identification of differences, amino acids in the table are colored according to common chemical properties (charge, polarity, etc.). Note that the ABCC family shows divergence adjacent to the NBD1 Walker B loop that is integral to ABS1 at the position indicated by an asterisk.Many ABC proteins feature homodimeric NBDs that together form two ABS sites with equivalent functions, but the monomeric ABCCs contain significant divergence in ABS1 (Gadsby et al., 2006). A sequence alignment of the relevant motifs (Fig. 9 B) demonstrates major points of divergence as compared with P-glycoprotein (ABCB1), which has essentially homodimeric NBDs. Note that the ABCC family shows divergence adjacent to the NBD1 Walker B loop that is integral to ABS1 at the position indicated by an asterisk in Fig. 9 B. Here, a critical catalytic glutamate conserved in canonical ABS sites (Orelle et al., 2003) is substituted in most ABCCs with an aspartate or serine in NBD1, and the following alanine is substituted with a proline (Payen et al., 2003). In ABCC1, these two substitutions may be responsible for increased affinity for ATP and significantly slowed ATP hydrolysis at ABS1 (the so-called incompetent site) as compared with the canonical ABS2 site (the “competent” site; Gao et al., 2000; Hagmann et al., 1999; Hou et al., 2000; Payen et al., 2003; Qin et al., 2008). In addition, the NBD2 signature sequence contributing to ABS1 is F/LSVGQ in most ABCCs, as opposed to the canonical LSGGQ as in ABCB1; this also may impact affinity for ATP (Smith et al., 2002). In CFTR, where ATP hydrolysis at ABS1 is essentially absent (Aleksandrov et al., 2002; Basso et al., 2003), there is additional, lineage-specific divergence evident in these alignments. In NBD1, instead of the conservative ABCC aspartate substitution for the catalytic glutamate adjacent to the Walker B region (asterisked position noted above), all CFTRs have a serine residue (e.g., S573 in hCFTR). Additionally, the NBD2 signature sequence integral to ABS1 of CFTR is also unique among ABCCs.What purpose in CFTR may degeneration/divergence in the NBD dimer interface serve? As explained previously, the ABC transporter duty cycle requires the consumption of ATP. Adaptation of the cycle for optimal chloride channel activity would ideally allow a maximal amount of chloride to be diffused per ATP consumed. In this regard, it is highly advantageous that members of the ABCC subfamily of proteins harbor a degenerate ABS1, because any ion channel built on this scaffold would only consume one ATP molecule per gating cycle rather than two. This potential is generally borne out by biochemical studies. Recently developed spectroscopic methods for measuring ATP hydrolysis from model ABC transporters support the general inference that homodimeric transporters catalyze ATP at a significantly higher overall rate than heterodimeric transporters (Collauto et al., 2017). Specific to mammalian transporters, the absolute ATP turnover rate for hCFTR as calculated from channel closing rate is ∼0.5/s (Li et al., 1996), which correlates well with published rates from purified, detergent-solubilized protein (∼130 nmol/mg/min; Liu et al., 2017). This rate is roughly half that of the homodimeric P-glycoprotein expressed and purified similarly (∼230 nmol/mg/min in the presence of substrate; Kim and Chen, 2018).It is not yet well understood how additional divergence found in CFTR orthologues may contribute to any unique behavior(s). In all jv-CFTRs, the signature sequence in NBD2 is LSHGH—more divergent from consensus than ABCC homologues in its substitution of histidine for the C-terminal glutamine found in canonical ABSs (Fig. 9 B; Smith et al., 2002). Interestingly, uniquely among CFTRs, the NBD2 signature sequence from the Lp-CFTR orthologue retains this canonical glutamine (LSEGQ). Whether the unique composition of the CFTR ABS1 is necessary for normal gating or ATP hydrolysis is a question that needs further study using rigorous biochemical and electrophysiological methods. One intriguing explanation has been proposed on the basis of recent FRET experiments on ABCC1/MRP1 demonstrating important differences in its NBD dynamics as compared with CFTR. Electrophysiological data from CFTR suggest that ATP hydrolysis is quickly followed by dedimerization of the NBD heterodimer (Csanády et al., 2010). However, in MRP1, the post-hydrolytic NBD dimer is apparently much longer lived (Wang et al., 2020). Could CFTR-specific divergence in the NBD interface play a role in tuning CFTR gating, making it highly responsive to ATP hydrolysis at ABS2? Support for this possibility is found in a study demonstrating that mutating certain amino acids in the CFTR NBD interface to ABC transporter consensus results in a highly stable ATP-dependent dimer and prolonged open channel burst durations (Tsai et al., 2010).Hypothesized route for the evolution of regulated channel activity in CFTRHow did CFTR evolve its indispensable channel function? Our analyses demonstrate that many of the amino acid residues and motifs that bestow on hCFTR its function and regulation were already present to different degrees in closely related but functionally divergent ancestors. Hence, it is possible to compare the sequence of CFTR with that of increasingly distant homologues, infer what features are common, and propose a chronology for the molecular evolution of CFTR function and its optimization (Fig. 10). From such analysis, we suggest that residues underpinning interdomain energetic signaling, degeneration of the ATPase activity in ABS1, and intracellular basic residues critical to future CFTR Cl channel activity were present in a common ancestor of the ABCC family (Fig. 10, point 1). Following divergence from ABCC5, an ancestor of ABCC4 and CFTR retained these features and added to them; at this point, many residues that would eventually line and stabilize the Cl channel pore of CFTR emerged, possibly in use to bind and transport anionic substrates (Fig. 10, point 2). A common CFTR ancestor accumulated critical channel-specific residues in TM6 and elsewhere, which led to secondary structure changes around a conserved proline (P355 in CFTR) and pore-stabilizing salt bridges. Some degree of phosphoregulation was present as well (Fig. 10, point 3). Finally, fine-tuning of channel regulation and pore architecture continued after the split between jawless vertebrate CFTRs and jv-CFTRs (Fig. 10, point 4), but was largely consolidated before significant additional speciation in jv-CFTRs. This timeline is ripe for exploration in functional experiments with mutagenesis guided by structural and bioinformatics analysis.Open in a separate windowFigure 10.ABCC subfamily dendrogram and proposed chronology of molecular evolution of CFTR function. (A) Dendrogram adapted from two previous studies on CFTR evolution (Jordan et al., 2008; Sebastian et al., 2013). Proteins discussed in this review are indicated with *. (B) Chronology of emergence of functional features of jv-CFTR, as supported by the analyses in this review. Ancestors labeled with circled numbers correspond to the dendrogram points in A.Translational relevance: Toward therapeutic development across ABC transportersAs discussed above, CFTR is clinically relevant to the pathogenesis of CF, an impactful genetic disease. The continued development of efficacious CFTR modulators requires a better understanding of the function of this channel. The modulators from Vertex, although highly efficacious, do not impact all patients with eligible CFTR genotypes, nor do they solve all of the problems in this multiple organ system disease or lead to long-term stabilization of lung function (Flume et al., 2018; Gauthier et al., 2020; Guimbellot et al., 2017; Konstan et al., 2017; Li et al., 2019; McKinzie et al., 2017; Moheet et al., 2021; Patel et al., 2020; Phuan et al., 2018), revealing a need to continue to study CFTR to develop new therapies (Davies et al., 2019; Grand et al., 2021; Veit et al., 2018). Understanding the nature of the stable open state may aid in the rational design of drugs that can lock mutant CFTR channels open, leading to increased Cl secretion and amelioration of CF disease and potentially some forms of chronic obstructive pulmonary disease and other lung disorders (Raju et al., 2016; Solomon et al., 2016a; Solomon et al., 2016b). Conversely, overactivity of CFTR may contribute to polycystic kidney disease (Hanaoka et al., 1996) and secretory diarrhea, including cholera (Thiagarajah and Verkman, 2003). A better understanding of CFTR may lead to the design of clinically useful inhibitors to treat these secretory disorders. Comparative pharmacology is conceptually tangential to evolution of function, particularly for synthetic drugs that are not mimics of natural ligands that CFTR could have “evolved” to bind. That being said, an improved understanding of the structural relationships between groups of ABC transporters may be relevant to the investigation of the mechanisms of action of CFTR-targeted drugs discovered through high-throughput screening. In fact, distant CFTR orthologues and transporter homologues may assist in the elucidation of mechanisms and binding sites of the Food and Drug Administration–approved CFTR-directed therapeutic compounds using approaches similar to those used to understand the action of CFTR inhibitors (Stahl et al., 2012). While data suggest that many pharmacological agents correct the folding of trafficking mutants of both CFTR (ABCC7) and P-glycoprotein (ABCB1; Loo et al., 2012), lumacaftor, which may bind MSD1 of CFTR (Loo et al., 2013), is unable to correct trafficking mutants of P-glycoprotein (Loo et al., 2012). The drug is, however, able to correct trafficking mutants of ABCA4 associated with macular degeneration (Sabirzhanova et al., 2015).VX-770/ivacaftor has been shown in some studies to potentiate (and therefore likely directly bind) CFTR from multiple species, including human, murine (i.e., in Cui et al., 2016; Cui and McCarty, 2015; but not in Van Goor et al., 2009; Bose et al., 2019), and Xenopus (Cui et al., 2016) orthologues. Surprisingly, Lp-CFTR is not potentiated by VX-770 (Cui et al., 2019a); in fact, a small degree of inhibition was observed. Recently, the Chen laboratory solved a cryo-EM structure of CFTR in the presence of VX-770 at 3.3 Å resolution (PDB accession no. 6O2P) and identified residues contributing to the binding energy (Liu et al., 2019). This study revealed that VX-770 binds at a cleft formed by TMs 4, 5, and 8 deep inside the membrane core (see Fig. 5) at the interface between protein and the membrane lipid. Whether this structure demonstrates the binding site responsible for therapeutic potentiation is currently unclear (Csanády and Töröcsik, 2019; Yeh et al., 2019), although the same site also coordinated another potentiator, GLPG1837 (Liu et al., 2019). The conservation in this binding site is mixed; of the amino acids whose mutation strongly affect affinity, some are highly conserved across CFTRs and ABCC4s (e.g., R933 in hCFTR, but not S308), whereas others are conserved among CFTRs but not with ABCC4s (e.g., Y304), and some sites are uniquely divergent in Lp-CFTR (e.g., F931, a proline in lamprey).A very recent study from the Bear laboratory (Laselva et al., 2021) explored VX-770 binding sites using photo-induced cross-linking. This study confirmed a position proximal to the site identified by the Chen laboratory, noted above, but also identified a site within the ICLs linking the TMDs to the NBDs. This second location, formed by residues in ICL4, was previously nominated as a VX-770 binding site by the observation that ICL4 was protected from hydrogen/deuterium exchange in the presence of drug (Byrnes et al., 2018). Note that ICL4 also is the portion of the TMDs that most closely approaches position F508, which is deleted in most CF alleles in North America (Mornon et al., 2008; Serohijos et al., 2008). Residues making the strongest contribution to binding energy at this second site include K1041, E1046, P1050, F1052, H1054, Y1073, and K1080. In their hands, mutation F1052A at the second site had a significantly (approximately fivefold) larger effect on VX-770 affinity than alanine mutations of aromatics within the first site. This site also is much closer to the NBDs and interestingly is adjacent to residues E543 and K968 (Fig. 11), which were previously identified as involved in signaling the state of NBD occupancy by ATP to the TMDs (Strickland et al., 2019; of note, K968 is type II divergent between CFTRs and ABCC4s, with the exception of Lp-CFTR, where the equivalent position bears a glutamine). Hence, this newly identified pocket may contribute to the mechanism by which VX-770 stabilizes the channel open state (Cui et al., 2019b; Langron et al., 2018). We note that all of the residues listed above that contribute to this second site are conserved in Lp-CFTR, which is not potentiated by VX-770 (Cui et al., 2019a), other than K1080 (a glutamine, in lamprey). A lack of functional potentiation is, however, at most indirect evidence of loss of binding. In fact, because a small degree of inhibition was observed, it is possible that the drug binds to a site or sites on Lp-CFTR similar to that on hCFTR but that the nature of the interaction is subtly altered by divergence in the site such that potentiation does not occur. Conceptual precedence for such a scenario may be found in the pharmacology of closely structurally related drugs that bind to similar sites on receptors but induce opposing functional outcomes, such as the dihydropyridine class of voltage-sensitive Ca2+ channel modulators (Zhao et al., 2019). The emergence of a biotinylated, photo–cross-linkable ivacaftor analogue (Laselva et al., 2021) is expected to significantly aid in the dissection of the effect of a given mutation on binding versus potentiation or inhibition.Open in a separate windowFigure 11.Residues contributing to second potential binding site for VX-770 are located in a domain tightly linked to channel opening and to the most common mutation causing CF disease. Residues from Laselva et al. (2021) are mapped onto the 6MSM structure from the Chen laboratory. Purple, lasso domain; orange, TM10 and TM11, whose cytoplasmic tails comprise ICL4; blue, sites contributing to VX-770 binding site; yellow, E543 and K968, identified by Strickland et al. (2019) as responsive to the occupancy of the NBDs by ATP; red, F508.ConclusionThere are many questions that have yet to be answered with respect to the structure–function relationship in CFTR and related transporters. Many of these questions now can be answered through the study of revertant mutants between groups, retracing a possible evolutionary path. The results of these studies have the potential to shed light on the structures of both channel and nonchannel ABC proteins and may reveal channel-specific features in CFTR that serve as levers for the pharmacological repair of mutant channels in patients with CF. Although this article focuses on only one member of the ABC transporter superfamily, CFTR (ABCC7), many others have been implicated in disease, including close relatives, such as P-glycoprotein (ABCB1) and MRPs 1, 4, and 5 (ABCC1, 4, and 5), which confer life-threatening resistance to therapeutics when overexpressed (Chen and Tiwari, 2011). The extent to which structural and functional information gained about one ABCC can be mapped to another is an important consideration in both the discovery and mechanistic understanding of therapeutics directed against these proteins. Looking forward, the study of the molecular evolution of function in ABC proteins may therefore lead to exciting advances in the pharmacological and structural understanding of these highly medically relevant proteins.  相似文献   

设为首页 | 免责声明 | 关于勤云 | 加入收藏

Copyright©北京勤云科技发展有限公司  京ICP备09084417号