Isozyme studies in provenance research of forest trees

Summary The nature and origin of the isozymes and the techniques for their detection in forest trees are briefly reviewed. The theories used to interpret the isozyme variation are summarized. Recent isozyme variation studies in provenance research are discussed in relation to known variation pattern detected by classical nursery and field tests. The populations of a tree species can be sometimes, but not always, distinguished by their isozyme patterns. For a number of species, relationships between environment of origin of the provenances and some isozyme frequencies have been statistically established. In one case (Picea sitchensis) where direct comparison between the variation pattern detected by isozymes and the genetic variation of silviculturally important traits was possible, no meaningful relationships between both patterns could be detected. Nei's genetic distances and indices of gene diversity do not appear to be useful in provenance research. The concept of genetic distance based on gene frequencies is probably not very useful in provenance research either.     

Expression of the enzyme-encoding genes under the influence of colchicine and triton X-100 in nongerminating seeds of sugarbeet (<Emphasis Type="Italic">Beta vulgaris</Emphasis> L.)

The expression of the enzyme-coding genes, controlling glucose-phosphate isomerase (GPI), malate dehydrogenase (MDH), and alcohol dehydrogenase (ADH), was examined in nongerminating seeds of sugarbeet after Triton X-100 (TX-100) and colchicine treatment. Two types of changes revealed included modification of the enzymatic loci expression (change of the isozyme electrophoretic mobility) and inactivation of standard profiles. In the MDH and GPI systems, these processes were found to be associated. Complete isozyme modification was accompanied with the disappearance of standard profiles. In the ADH system, the treatment with TX-100 and colchicine gave rise to two independent processes, including silencing of the Adh1 locus and the appearance of the ADH isozymes with abnormal electrophoretic mobility, which were probably the products of the Adh2 locus. It was suggested that the effect of TX-100 and colchicine on the expression of the enzyme-encoding genes examined depended on the intracellular localization of the encoded enzymes.     

DISTRIBUTION AND EVOLUTION OF A GLUCOSEPHOSPHATE ISOMERASE DUPLICATION IN THE LEGUMINOSAE

In the common bean, Phaseolus vulgaris, two loci encode cytosolic glucosephosphate isomerase (GPI) subunits, whereas in the garden pea, Pisum sativum, only one locus is expressed. As a working model, we proposed that this change in isozyme number was produced by a gene-duplication event in the lineage leading to Phaseolus after divergence from that leading to Pisum. This model was tested by analyzing the GPI phenotypes in 119 legume genera, representing all three subfamilies and 23 of the 30 tribes of the Papilionoideae. The duplication was detected in 13 of the 20 papilionoid tribes surveyed, including several members of the putatively primitive tribe Sophoreae. Thus, the duplication appears to be an ancient event, a finding incompatible with the initial hypothesis. Instead, gene silencing is postulated to account for the absence of the duplicated phenotype in many tribes, including such advanced groups as Vicieae, Trifolieae, and Cicereae. Furthermore, silencing has occurred numerous times at lower taxonomic levels, including the subtribe Phaseolinae (Phaseoleae), a monophyletic group in which ten genera were found to have duplicated phenotypes and only one (Strophostyles) appeared to have an unduplicated phenotype. Analysis of GPI phenotypes also revealed numerous cases of partial silencing of duplicate loci as well as nearly equal expression of both loci in many, taxonomically widely scattered species. If our revised hypothesis is correct, this latter result implies that most of the subtribes had formed before significant divergence between the GPI isozymes occurred and, thus, that the radiation of the Papilionoideae was rapid relative to the rate of gene silencing.     

EXTENSIVE GENE DUPLICATIONS IN DIPLOID EUPATORIUM (ASTERACEAE)

An electrophoretic study of isozyme number for seven soluble enzymes revealed extensive gene duplications in eight diploid species of American Eupatorium belonging to three morphological groups. The enzymes isocitrate dehydrogenase, phosphoglucomutase, phosphoglucose isomerase, 6-phosphogluconate dehydrogenase, and shikimate dehydrogenase occur as three to six isozymes in all species, whereas the minimal conserved number typical of diploid plants is two isozymes for each. Fructose 1, 6-biphosphate aldolase is expressed as multibanded pattern suggesting fixed heterozygosity in all examined species. It was not possible to document gene duplication for triosephosphate isomerase from the electrophoretic patterns. All species examined have a chromosome number of 2n = 20, which has been regarded as the basic diploid number for Eupatorium. However, the detection of extensive duplications suggests that 2n = 10 may be the original diploid chromosome number in Eupatorium and that plants with 2n = 20 are of polyploid origin. This hypothesis would mean that extensive duplications at isozyme gene loci have been maintained since the origin of the genus, despite chromosomal diploidization having occurred.     

Evaluation of isozyme systems in Citrus to facilitate identification of fusion products

Summary Ten isozymes were analyzed in nucellar calli of nine Citrus species and cultivars and roots of the corresponding apomictic seedlings. The zymograms obtained can be divided into three groups: a) isozyme patterns similar in both calli and roots, b) isozyme patterns similar in calli but variable in roots, and c) isozyme patterns variable in both calli and roots. Analysis of these ten isozyme systems may facilitate identification of fusion products in Citrus.Contribution from the Agricultural Research Organization, The Volcani Center, Bet Dagan, Israel. No. 354-E, 1982 series     

PHOSPHOGLUCOMUTASE AND ISOCITRATE DEHYDROGENASE GENE DUPLICATIONS IN LAYIA (COMPOSITAE)

Genetic analysis of isozyme segregation patterns in Layia (Compositae) showed that cytosolic phosphoglucomutase isozymes are encoded by duplicated genes, and that the cytosolic NADP-dependent isocitrate dehydrogenase isozymes are encoded by duplicated genes in species with haploid chromosome numbers of n = 7 and triplicated genes in those with n = 8. The duplicated genes specifying both isozymes assorted independently in all species tested. An electrophoretic survey of phosphoglucomutase in diploid species representing six additional genera of Madiinae, the subtribe to which Layia is assigned, revealed that Achyrachaena, Calycadenia, Hemizonia, Holocarpha, and Madia all possessed duplicated genes. In Lagophylla, one species also had duplicated genes for the isozyme but a second species did not, a loss probably resulting from mutation or chromosomal deletion. The phosphoglucomutase duplication characterizes nearly the entire subtribe and may prove useful to identify phylogenetic relationships between the Madiinae and other subtribes.     

Malate dehydrogenase (MDH; EC 1.1.1.37) isozymes in tissues and callus cultures ofCereus peruvianus (cactaceae)

Malate dehydrogenase (MDH; EC 1.1.1.37) isozymes were investigated in seeds and in seedlings and calli cultures ofC. peruvianus to determine if the changes in MDH isozyme banding patterns could be used as biochemical markers to identify the origin of regenerated plants from callus tissues. Four cytoplasmic MDH isozymes (sMDH), five mitochondrial MDH isozymes (mMDH), and one glyoxysomal MDH isozyme (gMDH) were detected and showed tissue- and stage-specific expression. A relationship of mMDH and gMDH isozyme patterns with callus tissues subcultured in three hormonal combinations and with the plants regenerated from these callus tissues was demonstrated. Furthermore, temperature and mechanical stress were found to be closely related to mMDH-1 activity in callus culture. Therefore, the different patterns of MDH isozymes in the various tissues ofC. peruvianus can be used as biochemical markers for the study of gene expression during development and as powerful tools in monitoring studies on callus cultures. This research was supported by the CNPq.     

Retina-specific LDH isozyme in blueback herring, Alosa aestivalis (Mitchell), and alewife, Aiosa pseudoharengus (Wilson)

The retina of 390 Alosa aestivalis and 410 Alosa pseudoharengus have been examined by means of starch-gel electrophoresis. The retina-specific E₄ isozyme has been found to occur in all the fish examined. This study demonstrates for the first time that the E₄ isozyme occurs in A. aestivalis. Because the E₄ isozyme is not polymorphic and has an identical mobility in A. pseudoharengus and in A. aestivalis it is neither suitable for use as a species identification characteristic nor a population marker. Alosa aestivalis and Alosa pseudoharengus are two commercially important ana-dromous species of fish in New Brunswick, Canada. These two species may occur together in the same spawning runs but w^rhile A. pseudoharengus has a wide distribution along the East coast of North America (Leim & Scott, 1966) A. aestivalis occurs in a very limited area in Canada where it is at the northern limit of its range and because of increasing threat of pollution has been listed by McAllister (1970) as one of 17 endangered species. These two species of fish are morphologically very similar and can only be separated by the colour of the abdominal peritoneum (Leim & Scott, 1966). McKenzie (1973) has compared these two species by means of protein electrophoresis and found that while the muscle myogen patterns were species specific, the LDH patterns were the same in both species. He described these two species as five isozyme fish showing the LDH isozymes A₄, A₃B, A₂B₂, AB₃ and B₄. Since Horowitz & Whitt (1972) have reported the presence of the E₄ isozyme in the retina of some teleosts including. A. pseudoharengus but not including A. aestivalis, I considered it worth-while to re-examine A. aestivalis and A. pseudoharengus to find out whether A. aestivalis possessed this isozyme and, if so, whether the mobility of the isozyme could be used as a species identification characteristic and as a population marker. The fish used in this study were collected from five different locations during the 1971 spring migration period and held deep frozen for eight months before they were examined. They were identical to the specimens used for the study reported by McKenzie (1973) where the collection dates, numbers of fish and geographic locations are given. One eyeball from each of 390 A. aestivalis and 410 A. pseudoharengus was removed. Each eyeball was homogenized in 10 drops of distilled water and allowed to stand for one hour at 4^oC. The samples were then centrifuged for 10 min at 12 000 g. The supernatants were used immediately for vertical starch-gel electrophoresis. The apparatus used was that described by Boyer & Hiner (1963). The conditions of electrophoresis were the same as used by Saunders & McKenzie (1971). The LDH bands were stained by the deposition of blue formazan dyes in the regions of LDH activity. The stain formula and details of methods are given in Whitt (1970). The LDH isozyme patterns of all the fish examined were identical. The location of the isozymes A₄, A₃B, A₂B₂, AB₃ and B₄ are indicated in Fig. 1. A₄ is abundant in muscle while B₄ is abundant in heart. Because the LDH subunits assemble preferentially into homodimeric pairs before forming tetramers (Markert & Ursprung, 1971). A₄. A₂B₂ and B₄ show up in electropherograms as strong bands while A₃B and AB₃ show up as weak bands. The retina-specific isozyme E₄ is shown between B₄ and AB₃. Whitt (1970) has already demonstrated that A. pseudoharengus is a five isozyme fish. This has been confirmed by McKenzie (1973) who also compared both A. pseudoharengus and A. aestivalis and found these five isozymes had identical mobilities in both species of fish. The present study demonstrates for the first time that the retina-specific E₄ occurs in A. aestivalis where it has the same electro-phoretic mobility as that of A. pseudoharengus. The patterns are the same and do not appear to vary with geographic origin of the fish. The reason why the presence of the E₄ isozyme was demonstrated in the present study and not in the previous one (McKenzie, 1973) is because of the method used. In that study the migration length was not long enough to sufficiently separate the enzymes. In the present study vertical starch-gel electrophoresis which allows for long migration distances was used. As has already been shown for the A-B isozymes (McKenzie, 1973), the E₄ isozyme is not polymorphic in these two species of fish. It therefore has no use as apopulation marker. Because the E₄ isozyme has an identical mobility in both species of fish, it cannot be used as a species identification characteristic.     

Patterns of genetic variability within and among populations of wild radish,Raphanus raphanistrum (Brassicaceae)

The genetic structure of populations is an important determinant of the evolutionary potential of a species. Colonizing plants tend to be characterized by low within- and high among-population variability. Genetic differentiation of both floral traits and isozymes was studied in six populations of wild radish (Raphanus raphanistrum). Evidence for differentiation in both sets of traits was found, but patterns of differentiation of floral traits did not coincide with isozyme differentiation. Contrary to most colonizing species, wild radish showed high within- and only moderate among-population variability at isozyme loci. In addition, levels of differentiation did not correspond to geographic distance between the populations. These results are likely due at least in part to the self-incompatibility system of this species, long-distance movement of large numbers of wild radish seeds by humans, and introgression from cultivated radish (R. sativus).     

Isozymic Characterization of Three Mating Groups of the Tetrahymena pyriformis complex*

SYNOPSIS. Strains of 3 unnamed mating groups of the Tetrahymena pyriformis complex have been subjected to starch gel electrophoresis followed by staining the gels for the enzymes isocitrate dehydrogenase (NADP), tyrosine aminotransferase, and tetrazolium oxidase (superoxide dismutase). With respect to the electrophoretic mobilities of these enzyme systems, the mating groups referred to here as 5, 13 and 14 are very similar to Tetrahymena americanis (syngen 2), the most common North American species of the complex. Cultures in our collection labeled Tetrahymena cosmopolitans (formerly syngen 4) are either amicronucleate, with unique isozyme patterns, or micronucleate cells which mate with and have isozyme patterns similar to Tetrahymena canadensis (syngen 7). Immature progeny have been derived from crosses between the latter strains and T. canadensis recently collected in Colorado. The amicronucleate strains are now placed in the Tetrahymena sp. category, and we conclude that strains identifiable as T. cosmopolitanis are no longer available. The reliability of isozymes as characters in ciliate taxonomy was evaluated by comparing the present results for 3 enzymes in 15 groups of strains (syngens and phenosets) that had been compared in an earlier study. These enzyme systems gave correlation coefficients (r) of 0.75 or higher in the separate studies, and can be considered useful diagnostic traits. Other enzymes that were present at threshold levels of detectability or varied highly in concentration from species to species are too unreliable to be of diagnostic value. Some of the strains in the complex are so evolutionarily divergent at the molecular level that we have difficulty finding growth and electrophoretic conditions under which orthologous enzyme activities can be detected simultaneously for all the strains being compared.     

Variation of isozyme patterns among Arachis species

The genus Arachis contains a large number of species and undescribed taxa with patterns of genetic variation that are little understood. The objectives of this investigation were to estimate genetic diversity among species of Arachis by utilizing electrophoretic techniques and to establish the potential for use of isozymes as markers for germplasm introgression. One-hundred-and-thirteen accessions representing six of the seven sections of the genus were analyzed for isozyme variation of 17 enzymes. Section Rhizomatosae species were not included because they produce very few seeds. Seeds were macerated and the crude extract was used for starch-gel electrophoretic analyses. Although the cultivated species has few polymorphic isozymes, the diploid species are highly variable and two-to-six bands were observed for each isozyme among accessions. Because of the large number of isozyme differences between A. hypogaea and A. batizocoi (the presumed donor of the B genome), this species can no longer be considered as a progenitor of the cultivated peanut. Seed-to-seed polymorphisms within many accessions were also observed which indicate that germplasm should be maintained as bulk seed lots, representative of many individuals, or as lines from individual plants from original field collections. The area of greatest interspecific genetic diversity was in Mato Grosso, Brazil; however, the probability of finding unique alleles from those observed in A. hypogaea was greatest in north, north-central, south and southeast Brazil. The large number of polymorphic loci should be useful as genetic markers for interspecific hybridization studies.     

Analysis of Pectic Enzyme Zymograms of Fusarium Species.

Zymograms of the extracellular polygalacturonase (PG), produced by isolates of F. culmorum and F. graminearum originating from different geographic locations and different sources, were compared. PG patterns were prepared by polyacrylamide gel electrophoresis (PAGE) and isoelectric focusing (IEF) of untreated fluid from liquid pectin salts cultures. There was no intraspecific variability between isolates of both Fusarium species. Electrophoretic and isofocusing PG patterns were species specific. On the basis of IEF patterns, F. culmorum (4 isozymes, estimated pI's 6.4, 6.6, 6.9, 7.1) and F. graminearum (5 isozymes, estimated pI's 6.4, 6.6, 6.9, 7.1, 7.5) could be separated from one another by the pH 7.5 PG isozyme.     

Phylogenetic and genetic studies in Papaver section Oxytona: cytogenetics,isozyme analysis and chloroplast DNA variation

Summary Chromosome behaviour at meiosis, isozyme studies and analysis of the chloroplast DNA restriction fragments were used to assess the phylogenetic relations among the three Papaver species of the section Oxytona. The multivalents observed in diplotene — diakinesis stages of meiosis of the hexaploid P. pseudo-orientale and its tetraploid hybrid with P. bracteatum indicate the autopolyploid nature of this section. Further evidence supporting this conclusion was obtained from isozyme analysis. The same number of isozymes was expressed in all the species regardless of their ploidy level. Inheritance studies conducted with Pgi, Dia and Acp allozymes demonstrated, for the first time, the transfer and expression of genetic material among these species. The differences found in the chloroplast DNA restriction fragments of the Oxytona species and of P. somniferum indicate intensive evolution of the chloroplast DNA in the genus Papaver. The similarity of the chloroplast DNA restriction patterns and of the isozymes in P. orientale and P. pseudo-orientale suggested that P. orientale was the female parent in the cross generating P. pseudo-orientale and that the latter species is of recent origin.Contribution no. 2199 —E, 1987 series from the Agricultural Research Organization, The Volcani center, Bet Dagan 50 250, Israel     

Variation and Morphogenetic Characteristics of Different Stachys Species during Microclonal Propagation

Morphogenesis of different Stachys species introduced in in vitro culture have been compared. The frequency of altered forms have been demonstrated to be related to the plant genotype. All regenerants of S. sieboldii, which reproduces in vivo only vegetatively, are phenotypically normal, irrespective of the concentrations of plant growth regulators at which they have been obtained. Only changes in isozyme patterns have been observed in the regenerants grown in media containing at least 10 mg/l benzyl aminopurine (BAP); most of these changes are the absence of a particular component of the pattern. The cross-pollinating species Stachys ocymastrum, which typically reproduces by seeds, has yielded morphologically altered forms even in phytohormone-free media; its isozyme patterns often contained a new component. Analysis of the isoperoxidase patterns of regenerants of both Stachys species obtained with the use of high phytohormone concentrations has demonstrated qualitative and quantitative changes suggesting the appearance of somaclonal variants even in the course of plant regeneration directly from nodal segments, bypassing callus formation. Changes have also been found in Stachysplants regenerating from the callus tissue.     

Isozyme gene markers in Vicia faba L.

Summary This study was conducted to assess the genetic basis of the variability observed for the glutamate oxaloacetate transaminase (GOT), Superoxide dismutase (SOD), esterase (EST), and malate dehydrogenase (MDH) isozyme systems in different open-pollinated Vicia faba varieties. Individual plants showing contrasting zymogram patterns were simultaneously selfed and cross-combined. Crossing was unsuccessful in producing progeny, and only selfed progenies were suitable for genetical analysis of isozyme variability. Three zones of GOT activity were made visible. The isozyme of GOT-2 and GOT-3 zones were dimeric and under the control of three alleles at the Got-2 locus and two alleles at the Got-3 locus, respectively. The isozymes of the GOT-1 zone did not show any variability. Three zones of SOD isozyme activity were made visible. The isozymes occurring in the SOD-1 (chloroplastic isozyme form) and SOD-2 (cytosol isozyme form) zones were dimeric and under the control of two alleles at the Sod-1 and Sod-2 loci. The isozyme visualized in the SOD-3 zone (mitochondrial isozyme form) were tetrameric and under the control of two alleles at the Sod-3 locus. Apparently the isozymes made visible in the most anodal esterase zones EST-1, EST-2, and EST-3 were monomeric, and the occurrence of two alleles at each of two different loci explained the variability observed in the EST-2 and EST-3 zones. For MDH, only two five-banded zymogram pattern types were found, and every selfed progeny showed only one of the two zymogram type, indicating that each individual possessed fixed alleles at the loci controlling MDH isozyme. Got-2, Got-3, Sod-1, Sod-2, and Sod-3 appear to be five new isozyme gene markers that can be useful in Vicia faba breeding for linkage study, varietal fingerprinting, outcrossing rate estimate, and indirect selection for quantitative characters.     

Malate Dehydrogenase Isozymes (MDH; EC 1.1.1.37) in Long-Term Callus Culture of Cereus peruvianus (Cactaceae) Exposed to Sugar and Temperature Stress

Malate dehydrogenase (MDH; EC 1.1.1.37) isozymes in long-term callus tissue culture of Cereus peruvianus were studied in starch gel electrophoresis to investigate the control of differential Mdh gene expression under sugar and temperature stress. While two cytosol MDH isozymes showed an unchanged phenotype when the callus tissues were transferred to medium maintained at 22 or 37°C and containing different concentrations of sucrose, glucose, and fructose, the different combinations of five mitochondrial MDH (mtMDH) and two microbody MDH (mbMDH) showed different MDH isozyme patterns in the callus populations. Differential expression of mtMDH isozymes seems to be modulated at the posttranslational level in callus tissues exposed to different concentrations and types of sugar and to high-temperature and low-temperature stress. An inductor effect on the expression of mbMDH isozymes was observed under stress conditions and in long-term callus tissue, and they may also present different responses.     

Pyruvate kinase isozymes in adult tissues and eggs of Rana pipiens. Comparative studies on the properties of the different isozymes

The properties of the isozymes of pyruvate kinase (ATP: pyruvate phosphotransferase, EC 2.7.1.40) found in unfertilized frog egg have been compared to those found in adult tissues of Rana pipiens. Chromatographic, kinetic, and electrophoretic data indicate that, of the five electrophoretic forms found in egg, the isozyme with the least anodic mobility (isozyme I) is the same molecular species as the only isozyme found in heart, and the egg isozyme with the greatest anodic mobility (isozyme V) is identical to the major isozyme found in liver.The activity of egg isozyme I was markedly inhibited by the antibody to the skeletal muscle enzyme, which has been shown previously to cross-react with the cardiac enzyme, but was unaffected by the antibody to liver isozyme V; the opposite effects were observed with egg isozyme V. The antibody to the skeletal muscle enzyme inhibited egg isozymes II > III > IV whereas the antibody to the liver enzyme gave the reverse inhibitory pattern, e.g., isozyme IV > III > II.In vitro dissociation-reassociation of mixtures of isozyme I and V led to the formation of the other three isozymes. Similar experiments performed individually with either egg isozyme III or IV resulted in the production of predominantly isozymes III, II, and I due to the instability of isozyme V during the hybridization procedure.The above results indicate that isozymes I and V are tetramers of the respective parental subunits and that isozymes II, III, and IV are hybrid molecules with subunit assignments of (I₃V₁), I₂V₂), and (I₁V₃), respectively.     

Effects of organic acids on lipid synthesis and ecdysis in Triatoma infestans eggs

Scarce bibliographical data exists on the enzymes in Lepidosiren paradoxa and analysis of several enzymes was considered worthy of investigation. Distribution of ADH, ALP, FBALD, GAPDH, G3PDH, G6PDH, GPI, LDH, MDH, and PGM was identified in ten tissues (retina, heart, muscle, liver, kidney, lung, gut, gills, brain, and ovary) of the South American lungfish and compared with patterns previously described in other vertebrates. Compared with earlier results differences in the number of loci expressed were observed for ADH, G3PDH, GPI, and MDH. The number of loci expressed and/or in tissue specificity of several enzymes (ADH, FBALD, GAPDH, G3PDH, G6PDH and PGM) were found to be similar to those of other vertebrates. Differences were detected in ALP due to the absence of an intestinal-specific form typical of fish, amphibians, reptiles and birds; further differences were observed in GPI and MDH due to their tissue expression. The differences in LDH involve the LDH-A₄ isozyme which was most common in tissues. Overall, comparison with other vertebrates reveals that in L. paradoxa the tissue-restricted expressions of some enzymes are similar, while others have retained an ancestral pattern and exhibit a more widespread tissue expression of genes.     

Amino acid sequence of high-redox-potential ferredoxin (HiPIP) isozymes from the extremely halophilic purple phototrophic bacterium, Ectothiorhodospira halophila

The amino acid sequences of high-redox-potential ferredoxin (HiPIP) isozymes from Ectothiorhodospira halophila have been determined. These are: isozyme I, EPRAEDGHAHDYVNEAADPSHGRYQEGQLCENCAFWGEAVQDGWGRCTHPDFDEVLVKAEGWCSVYAPA S, and isozyme II, GLPDGVEDLPKAEDDHAHDYVNDAADTDHARFQEGQLCENCQFWVDYVNGWGYCQHPDFTDVLVRGEGW CSVYAPA. Isozyme II is the major form of HiPIP produced by the bacterium (65-80%) and is the most acidic of the known HiPIPs. The two isozymes are 72% identical to one another and require only a single residue deletion for alignment. Comparison of these HiPIPs with seven previously determined sequences revealed only 27% average identity. Both E. halophila HiPIP isozymes are likely to be functional since their sequences are equally distant from those of other species. The E. halophila HiPIP sequences show that H-bonding patterns recognized in Chromatium vinosum HiPIP are likely to be conserved and therefore cannot explain the unusually low redox potentials which have been reported.