共查询到20条相似文献,搜索用时 0 毫秒
1.
Dennis Wilkens Juhl Wilma van Rensburg Xavier Bossis J. Arnold Vosloo Marina Rautenbach Burkhard Bechinger 《Journal of peptide science》2019,25(5)
Tyrocidines are a family of cyclic decapeptides produced by the soil bacterium, Brevibacillus parabrevis. These antibiotic peptides can be used to prevent infections in agriculture and food industry but also to prepare antimicrobial lozenges, creams, and dressings for medical applications. It has been observed that the tyrocidines interact with saccharides such as cellulose from their soil environment, as well as sugars in culture media and glycans in fungal cell walls. Here, we investigated the interactions of tyrocidines with glucose, sucrose, and cellotetraose (as cellulose model) in a quantitative fashion utilising CD and NMR spectroscopy. The CD and NMR spectra of tyrocidine A (TrcA) were analysed as a function of solvent composition, and the spectral properties agree with the formation of oligomeric structures that are governed by β‐sheet secondary structures once the acetonitrile content of the solvent is increased. Saccharides seem to also induce TrcA spectral changes reverting those induced by organic solvents. The CD spectral changes of TrcA in the presence of glucose agree with new ordered H‐bonding, possibly β‐sheet structures. The amides involved in intramolecular H‐bonding remained largely unaffected by the environmental changes. In contrast, amides exposed to the exterior and/or involved in TrcA intermolecular association show the largest 1H chemical shift changes. CD and NMR spectroscopic investigations correlated well with TrcA‐glucose interactions characterized by a dissociation constant around 200 μM. Interestingly, the association of cellotetraose corresponds closely to the additive effect from four glucose moieties, while a much higher dissociation constant was observed for sucrose. Similar trends to TrcA for binding to the three saccharides were observed for the analogous tyrocidines, tyrocidine B, and tyrocidine C. These results therefore indicate that the tyrocidine interactions with the glucose monosaccharide unit are fairly specific and reversible. 相似文献
2.
Acid-induced denaturation of the ribonuclease HI protein from Escherichia coli was analyzed by CD and NMR spectroscopies. The CD measurement revealed that the acid denaturation at 10 degrees C proceeds from the native state (N-state) to a molten globule-like state (A-state), through an apparently more unfolded state (U(A)-state). In (1)H-(15)N heteronuclear single-quantum coherence (HSQC) spectra, cross peaks from the N-state and those from the other two states are distinctively observed, while the U(A)-state and A-state are not distinguished from each other. Cross peaks from the U(A)/A-states showed a small pH dependence, which suggests a similarity in the backbone structure between the two states. The direct hydrogen-deuterium (H-D) exchange measurement at pH with the largest population of U(A)-state revealed that at least alpha-helix I is highly protected in the structure of the U(A)-state. A pH-jump H-D exchange analysis showed that the protection of alpha-helix I is highest also in the A-state. The profile of hydrogen-bond protection indicated that the structure of the A-state is closely related to that of the kinetic folding intermediate. 相似文献
3.
D. Camboli J. Besancon J. Tirouflet B. Gautheron P. Meunier 《Inorganica chimica acta》1984,91(2):145-147
Bis-derivatives of phenylantimony(III) with some monothio-β-diketones have been synthesized and characterized as five coordination species by elemental analyses, molecular weight and spectral data. The stereochemistry of the complexes having asymmetrical ligands is discussed. 相似文献
4.
Alverdi V Giovagnini L Marzano C Seraglia R Bettio F Sitran S Graziani R Fregona D 《Journal of inorganic biochemistry》2004,98(6):1117-1128
The precursors [M(ESDTM)Cl(2)] (M=Pt(II), Pd(II); ESDTM=EtO(2)CCH(2)(CH(3))NCS(2)Me, S-methyl(ethylsarcosinedithiocarbamate)) were synthesized as previously reported [J. Inorg. Biochem. 83 (2001) 31] and used to obtain [M(ESDT)Cl](n) (ESDT=ethylsarcosinedithiocarbamate anion) species. The complexes formed through reaction between [M(ESDT)Cl](n) and the two chiral amino-alcohols synephryne (Syn) and norphenylephrine (Nor) have been synthesized, with the ultimate goal of preparing mixed dithiocarbamate/amino metal complexes of the type [M(ESDT)(Am)Cl] (Am=Syn, Nor). These compounds have been isolated, purified and characterized by means of FT-IR, mono- and bidimensional NMR spectroscopy and mass spectrometry ESI/MS (electronspray mass spectra). The experimental data suggest that in all cases coordination of the dithiocarbamate ligand (ESDT) takes a place through the two sulfur atoms, the -NCSS moiety acting as a symmetrical bidentate chelating group, in a square-planar geometry around the M(II) ion, while the other two coordination positions are occupied by the chlorine atom and the amino-alcohol ligand, respectively. In particular, synephrine and norphenylephrine appear to be bound to the metal atom through the amino nitrogen atom by means of a dative bond. Finally, the biological activity of the new complexes has been studied by MTT (tetrazolio salt reduction) test and by detecting the inhibition of DNA synthesis and of clonal growth in various cancer cell lines. All Pd(II) derivatives showed a noticeable activity very close to that of cisplatin, used as reference drug. Moreover, they showed significantly reduced cross-resistance to cisplatin in a pair of cell lines (2008/C13*) with known acquired cisplatin resistance mechanisms. 相似文献
5.
Facchin G Torre MH Kremer E Piro OE Castellano EE Baran EJ 《Journal of inorganic biochemistry》2002,89(3-4):174-180
Three new copper(II) complexes of stoichiometry [Cu(L-dipeptide)].nH(2)O, containing as ligands the dipeptides L-alanine-L-isoleucine, L-alanine-L-threonine and L-alanine-L-tyrosine were prepared. They were characterized by single crystal X-ray diffractometry, and electronic and infrared spectroscopy. In all cases, the Cu(II) cation has essentially the same elongated square pyramidal coordination, being equatorially cis coordinated by a N(2)O(2) arrangement of ligand atoms and axially by a carbonyl oxygen atom. The compounds show rather similar polymeric structures which resemble those recently reported for the [Cu(ala-val)] and [Cu(ala-phe)] complexes. The electronic and infrared spectra are briefly discussed on the basis of the structural peculiarities of the complexes. Superoxide dismutase (SOD)-like activity was also tested for the compounds. 相似文献
6.
Plots of stability constant logarithms versus pKa for dienPd2+ binding to a variety of nitrogen heterocycles yield straight lines, all of 0.67 slope. Points for binding at pyridine like purine N1 and pyrimidine N3 nitrogens in nucleosides and 5′-mononucleotides fall on a single straight line. The base line for binding at imidazole like purine N7 nitrogens is 0.8 log units stronger than for N1 binding. N7 binding to purine bases with a 6-oxo group is enhanced by 1.6 log units above the N7 base line. The presence of a 5′-phosphate group enhances N7 binding (but not N1 binding) by 0.5–0.7 log units. Weaker binding occurs with pmdienPd2+ and the straight line slopes are 0.79. The N7 base line rises 1.2 log units above the N1 line. Presence of the 6-oxo group enhances pmdien binding by 2.3 units ruling out a significant coordinated dien hydrogen bond to the 6-oxo group. There is no enhancement of pmdienPd2+ binding to N7 due to the 5′-phosphate of nucleotides. This result suggests that the 0.5–0.7 log unit enhancement for dienPd2+ is due to a hydrogen bond from coordinated dien to the phosphate. Due to the terminal methyl groups, rotation of pyrimidines, benzimidazole, and purines is restricted in pmdienPd2+ complexes and two rotamers are evident in proton magnetic resonance spectra. With benzimidazole and purine nucleosides and 5′-nucleotides there is an approximately 2:1 mole ratio of the two rotamers. Nuclear Overhauser effect experiments and chemical shift analysis permit identification of all peaks for pmdien methyl groups and aromatic ring protons. 相似文献
7.
The reaction between an equimolecular mixture of isocyanide CNR (CNR = di-methylphenyl isocyanide (DIC), tert-butyl isocyanide (TIC), triphenyl phosphane (PPh3) and a dechlorinated solution of the palladium allyl dimers [Pd(η3-allyl)Cl]2 (allyl = 2-Meallyl, 1,1-Me2allyl) in stoichiometric ratio yields the mixed derivative [Pd(η3-allyl)(CNR)(PPh3)] only. Apparently, the mixed derivative represents the most stable species among all the possible ones that might be formed under those experimental conditions. Theoretical calculations are in agreement with the experimental observation and the energy stabilization of the mixed species with respect to the homoleptic derivatives is traced back to an overall push-pull effect exerted by the isocyanide and the phosphane acting synergically. Similar behavior is observed in the case of the synthesis of the palladacyclopentadienyl complexes [Pd(C4(COOMe)4)(CNR)(PPh3)] and of the palladium(0) olefin complexes whose synthesis invariably yields the mixed [Pd(η2-olefin)(CNR)(PPh3)] derivatives. The paper includes studies on the reactivity toward allylamination in the case of the palladium(II) allyl complexes. A diffractometric investigation on the solid state structures of four different palladium isocyanide-phosphane complexes is also included. 相似文献
8.
Cobalt(II) arsanilazotyrosine-248 carboxypeptidase A has been characterized through 1H NMR spectroscopy. The ability of the azoenzyme to form binary and ternary complexes with L- and D-phenylalanine and azide has been investigated. Comparison with the 1H NMR results obtained on unmodified cobalt(II) carboxypeptidase provides direct information on the specific effect of the presence of the azo group on the reactivity of the system. Marked differences in the interaction with D-phenylalanine have been observed, and structural inferences are drawn. 相似文献
9.
The structure of the model protein hen egg-white lysozyme dissolved in water and in five neat organic solvents (ethylene glycol, methanol, dimethylsulfoxide (DMSO), formamide, and dimethylformamide (DMF)) has been examined by means of 1H NMR and circular dichroism (CD) spectroscopies. The NMR spectra of lysozyme reveal the lack of a defined tertiary structure in all five organic solvents, although the examination of line widths suggests the possibility of some ordered structure in ethylene glycol and in methanol. The near-UV CD spectra of the protein suggest no tertiary structure in lysozyme dissolved in DMSO, formamide, and DMF, while a distinctive (albeit less pronounced than in water) tertiary structure is seen in ethylene glycol and a drastically changed one in methanol. A highly developed secondary structure was observed by far-UV CD in ethylene glycol and methanol; interestingly, the alpha-helix content of the protein in both was greater than in water, while the beta-structure content was lower. (Solvent absorbance in the far-UV region prevents conclusions about the secondary structure in DMSO, formamide and DMF.) Copyright 1999 John Wiley & Sons, Inc. 相似文献
10.
《Inorganica chimica acta》1986,124(3):169-173
Several copper(II)-dipeptide complexes were investigated in water-solvent (acetonitrile, N,N- dimethylformamide and dimethylsulfoxide) mixtures by electrochemical methods. The effects of the solvents on the reduction potentials of the copper- (II) dipeptide complexes were discussed. The reduction potentials in mixed solvents were different from those in aqueous solution and the order of reduction potentials was found to be due to the functional groups of the amino acid residue of the peptides in spite of quasi-reversible electrode reactions for the complexes. 相似文献
11.
《Journal of inorganic biochemistry》1987,30(1):35-43
Perturbations of the 1H NMR spectrum of the free base of Adriamycin in DMF solution were found when MCl2(DMF)2 (M = Pd or Pt) was added to the Adriamycin solutions. These perturbations were greatest for the 3' proton on the sugar ring and the effect decreased as the distance from this site increased. No changes were observed in the NMR spectrum of the rest of the molecule nor was there any color change when the metal solutions were added. This is interpreted as evidence that Adriamycin binds to these metals at the 3 ' amino group in DMF solution and that there is no reaction at the chromophore. The complexes were found to be in the fast exchange regime on the NMR time scale. As well, some products were isolated from reactions of Adriamycin with MCl2(DMF)2 in 20% MeOH/CH2Cl2 and MCl2 in DMF solution. They were characterized by their elemental analyses, as well as by 1H NMR and infrared spectroscopies. 相似文献
12.
The mechanism of transport of Pt(II) and Pd(II) into tissues through blood and that of their elimination in kidney is incompletely known so far. In this respect, the binding of palladium by the tripeptide glycyl-L-histidyl-L-lysine (GHL), a constituent of the human plasma, as a binary complex, and by the nucleotides 5'-IMP and 5'-GMP, as ternary complexes, has been studied by 1H and 13C NMR spectroscopy. These studies have been conducted in aqueous media and at different ligand/metal ratios. At acidic pH, resonances were observed for binary and ternary kinetically stable complexes, and binding sites in these complexes were identified by the effect of binding on chemical shifts of protons and carbon resonances. From these data, stoichiometries and structures of these complexes were proposed. 相似文献
13.
The interaction of several aromatic cationic dyes such as, ethidium bromide (EB), methylene blue (MB), acridine orange (AO), and Hoechst 33258 with calf-thymus DNA and poly(A)-poly(U) duplex was investigated. The different induced extrinsic Cotton effects (greater than 300 nm) were observed for DNA- and RNA-dye complexes. The binding properties of these complexes were examined by UV, CD, and NMR spectroscopies. 相似文献
14.
Gianfranco Bellachioma Barbara Binotti Giuseppe Cardaci Carla Carfagna Alceo Macchioni Stefano Sabatini Cristiano Zuccaccia 《Inorganica chimica acta》2002,330(1):44-51
Complexes [M(η1,η2-C8H12OMe)((2,6-(R)2---C6H3)N=C(R′)---C(R′)=N((2,6-(R)2---C6H3))]PF6 (where M=Pd, R=H and R′2=Me2 (1), M=Pd, R=Me and R′2=Me2 (2), M=Pd, R=Et and R′2=Me2 (3), M=Pd, R=iPr and R′2=Me2 (4), M=Pd, R=iPr and R′2=An (5), M=Pt, R=iPr and R′2=An (6)) were synthesized by the reaction of [M(η1,η2-C8H12OMe)Cl]2 with the appropriate α-diimine ligand in the presence of NH4PF6. Their ion pair structure in solution was investigated by detecting dipolar interactions between protons belonging to the cation and fluorine nuclei of the anion (interionic contacts) in the 19F, 1H-HOESY NMR spectra. In complexes 1–4, the anion in solution is located close to the peripheral protons of the α-diimine ligand and it interacts with the R′ protons and with the R protons that point toward the R′ groups. The steric protection of apical position exerted by the R substituents is clearly illustrated by the absence of interionic contacts between any protons of the cycloctenylmethoxy-moiety and the anion for R≥Me in 1–4. In complexes 5 and 6 the interactions between the anion and the peripheral N,N protons also predominate but other anion–cation orientations are significantly present and, consequently, the interionic structure is less specific. 相似文献
15.
Novel palladium(II) complexes with salen-type ligands based on 3-methylsalicyladehyde and a set of aliphatic diamines (C1 to C4) have been synthesised and characterized by spectroscopic techniques (UV-Vis and FTIR), Density Functional Theory (DFT) calculations and single-crystal X-ray diffraction for C1 and C4. X-ray diffraction analysis of these complexes was focused on coordination sphere and supramolecular arrangements. In the two compounds, the molecules form dimers, being the most relevant intermolecular interactions the hydrogen bonds of the type C-H?O, C-H?π and π?π stacking interactions between the six-membered metallocycles.Electronic spectra of all Pd(II) complexes are dominated by charge transfer and intraligand bands at λ < 400 nm. DFT calculations showed that the HOMO is ligand-dominated, with the metal contribution being ∼18% for all complexes. This suggests that the structural/electronic differences between the ligands do not influence significantly the participation of metal orbitals in HOMO. All the complexes exhibit dipole moments with the same direction, from the aldehyde moiety towards the imine bridge with C2 and C3 showing quite similar values, μC2 = 5.49 and μC3 = 5.54 D, whereas complexes C1 and C4 show slightly higher values: μC1 = 5.79 and μC4 = 6.17 D. The magnitude of bond lengths and angles predicted by DFT calculations are comparable to those determined by X-ray crystallography.The experimental vibrational frequencies of the Pd(II) complexes were correlated with the values estimated by DFT calculations. The good agreement between the experimental and theoretical vibrational data allowed the assignment of relevant IR bands to molecular vibration modes. 相似文献
16.
The B----Z transition in two synthetic oligonucleotides: d(C-2-amino-ACGTG) and d(m5CGCAm5CGTGCG) studied by IR, NMR and CD spectroscopies. 下载免费PDF全文
J A Taboury S Adam E Taillandier J M Neumann S Tran-Dinh T Huynh-Dinh B Langlois d'Estaintot M Conti J Igolen 《Nucleic acids research》1984,12(15):6291-6305
The sequences CA'CGTG (where A' = 2-aminodeoxyadenosine) and m5CGCAm5CGTGCG are prepared and studied by IR, CD and 1H-NMR. Infrared spectra demonstrate the capacity of the modified hexamer and decamer to adopt a Z conformation. The influence of the NH2 substitution on the adenine or of the methylated terminal part of the decamer acting with the increase of the DNA concentration stabilizes the Z conformation at room temperature in low humidity films. Very weak proportion of Z conformation is detected in UV dilute solutions. In more concentrated NMR solutions, the Z proportion induced by high salt content is only 20-25%. The effects of the concentration and of the covalent modification of the bases are discussed. 相似文献
17.
The tau protein plays an important role in some neurodegenerative diseases including Alzheimer's disease (AD). Neurofibrillary tangles (NFTs), a biological marker for AD, are aggregates of bundles of paired helical filaments (PHFs). In general, the alpha-sheet structure favors aberrant protein aggregates. However, some reports have shown that the alpha-helix structure is capable of triggering the formation of aberrant tau protein aggregates and PHFs have a high alpha-helix content. In addition, the third repeat fragment in the four-repeat microtubule-binding domain of the tau protein (residues 306-336: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ, according to the longest tau protein) adopts a helical structure in trifluoroethanol (TFE) and may be a self-assembly model in the tau protein. In the human brain, there is a very small quantity of copper, which performs an important function. In our study, by means of matrix assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS), circular dichroism (CD), and nuclear magnetic resonance (NMR) spectroscopy, the binding properties of copper (II) ion to the R3 peptide derived from the third repeat fragment (residues 318-335: VTSKCGSLGNIHHKPGGG) have been investigated. The results show that copper ions bind to the R3 peptide. CD spectra, ultraviolet (UV)-visible absorption spectra, and MALDI-TOF MS show pH dependence and stoichiometry of Cu2+ binding. Furthermore, CD spectra and NMR spectroscopy elucidate the copper binding sites located in the R3 peptide. Finally, CD spectra reveal that the R3 peptide adopts a mixture structure of random structures, alpha-helices, and beta-turns in aqueous solutions at physiological pH. At pH 7.5, the addition of 0.25 mol eq of Cu2+ induces the conformational change from the mixture mentioned above to a monomeric helical structure, and a beta-sheet structure forms in the presence of 1 mol eq of Cu2+. As alpha-helix and beta-sheet structures are responsible for the formation of PHFs, it is hypothesized that Cu2+ is an inducer of self-assembly of the R3 peptide and makes the R3 peptide form a structure like PHF. Hence, it is postulated that Cu2+ plays an important role in the aggregation of the R3 peptide and tau protein and that copper (II) binding may be another possible involvement in AD. 相似文献
18.
Silva RA Yasui SC Kubelka J Formaggio F Crisma M Toniolo C Keiderling TA 《Biopolymers》2002,65(4):229-243
Model peptides based on -(Aib-Ala)(n)-, and (Aib)(n)-Leu-(Aib)(2) sequences, which have varying amounts of 3(10)-helical character, were studied by use of vibrational and electronic circular dichroism (VCD and ECD) and Fourier transform infrared (FTIR) absorption spectroscopies to test the correlation of spectral response and conformation. The data indicate that these peptides, starting from a length of about four to six residues, predominantly adopt a 3(10)-helical conformation at room temperature. The longest model peptides, depending on the series, may evidence some alpha-helical contribution to the spectra, while the shorter ones, with less than six residues, have much less order. The IR absorption spectra (as supported by theory) showed only small frequency changes between 3(10)- and alpha-helices. By contrast, solvent effects are a source of much bigger perturbations. The ECD results show that the intensity ratio for the approximately 222-nm to approximately 208-nm bands, while useful for distinguishing between these two helical types in some sequences, may have a narrower range of application than VCD. However, the VCD data presented here continue to support the proposed discrimination between alpha- and 3(10)-helices based on qualitative amide I and II bandshape differences. The present study shows the intensities of the 3(10)-helical amide I (peak-to-peak) to its amide II VCD to be of the same order and useful for discriminating them from alpha-helices, whose amide I dominates the amide II in intensity. This qualitative result is experimentally independent of the amount of alphaMe-substituted residues in the sequence. These experimental VCD results are consistent in detail with theoretical spectral simulations for Ac-(Ala)(8)-NH(2), Ac-(Aib-Ala)(4)-NH(2), and Ac-(Aib)(8)-NH(2) in 3(10)- and alpha-helical conformations. 相似文献
19.
《Journal of enzyme inhibition and medicinal chemistry》2013,28(4):557-564
Four complexes [Pd(L)(bipy)Cl]·4H2O (1), [Pd(L)(phen)Cl]·4H2O (2), [Pt(L)(bipy)Cl]·4H2O (3), and [Pt(L)(phen)Cl]·4H2O (4), where L = quinolinic acid, bipy = 2,2’-bipyridyl, and phen = 1,10-phenanthroline, have been synthesized and characterized using IR, 1H NMR, elemental analysis, and single-crystal X-ray diffractometry. The binding of the complexes to FS-DNA was investigated by electronic absorption titration and fluorescence spectroscopy. The results indicate that the complexes bind to FS-DNA in an intercalative mode and the intrinsic binding constants K of the title complexes with FS-DNA are about 3.5?×?104 M?1, 3.9?×?104 M?1, 6.1?×?104 M?1, and 1.4?×?105 M?1, respectively. Also, the four complexes bind to DNA with different binding affinities, in descending order: complex 4, complex 3, complex 2, complex 1. Gel electrophoresis assay demonstrated the ability of the Pt(II) complexes to cleave pBR322 plasmid DNA. 相似文献
20.
van Mierlo CP van den Oever JM Steensma E 《Protein science : a publication of the Protein Society》2000,9(1):145-157
The denaturant-induced (un)folding of apoflavodoxin from Azotobacter vinelandii has been followed at the residue level by NMR spectroscopy. NH groups of 21 residues of the protein could be followed in a series of 1H-15N heteronuclear single-quantum coherence spectra recorded at increasing concentrations of guanidinium hydrochloride despite the formation of protein aggregate. These NH groups are distributed throughout the whole apoflavodoxin structure. The midpoints of unfolding determined by NMR coincide with the one obtained by fluorescence emission spectroscopy. Both techniques give rise to unfolding curves with transition zones at significantly lower denaturant concentrations than the one obtained by circular dichroism spectroscopy. The NMR (un)folding data support a mechanism for apoflavodoxin folding in which a relatively stable intermediate is involved. Native apoflavodoxin is shown to cooperatively unfold to a molten globule-like state with extremely broadened NMR resonances. This initial unfolding step is slow on the NMR chemical shift timescale. The subsequent unfolding of the molten globule is faster on the NMR chemical shift timescale and the limited appearance of 1H-15N HSQC cross peaks of unfolded apoflavodoxin in the denaturant range studied indicates that it is noncooperative. 相似文献