共查询到20条相似文献,搜索用时 15 毫秒
1.
N. D. De With 《Journal of comparative physiology. B, Biochemical, systemic, and environmental physiology》1996,166(5):337-343
InLymnaea stagnalis, oral uptake of ambient medium was studied using51Cr-ethylenediaminetetra-acetic acid. In normal snails Cr-ethylenediaminetetra-acetic acid uptake showed two components: a
high uptake rate within the first hour followed by moderate uptake proportional with time. The tracer accumulated mainly in
the digestive system. All animals showed initial, transient uptake. Moderate uptake proportional with time did not occur in
snails in which the buccal ganglia had been extirpated, in which both the buccal ganglia had been extirpated and the oesophagus
was sectioned, or in snails provided with an oesophageal fistula. These snails did not accumulate tracer in the intestinal
system. This type of tracer accumulation clearly represented oral ingestion of surrounding water. The oral water ingestion
rate ranged from 8 to 12 μl·h−1·g−1. Assuming complete absorption, this accounts for 20–30% of the urine production rate. At low external concentrations the
contribution of oral water ingestion to Na+ balance is negligible. However, its importance will grow with increasing external concentrations and becomes a major factor
at higher concentrations. The ingestion rate increased almost sixfold when starving snails were allowed to feed. It is suggested
that oral water ingestion is a consequence of making bite cycles and swallowing. 相似文献
2.
《Comparative biochemistry and physiology. A, Comparative physiology》1984,77(1):99-103
- 1.1. Final urine is intermittently released from the pneumostome of the pulmonate freshwater snail Lymnaea slagnalis. A technique is described to sample this fluid.
- 2.2. The ionic composition of final urine greatly differs from that of haemolymph; Na+ and Cl− are reabsorbed to a considerable degree. In lettuce fed snails K+ is excreted.
- 3.3. The urine Na+ and Cl− concentrations are about 38 and 31 mM lower, respectively, than the haemolymph concentrations, also when the latter concentrations vary.
3.
Morphological and histochemical examination of the blood and connective tissue of the freshwater snail Lymnaea stagnalis injected with various types of foreign particulate materials has shown the existence of free as well as fixed phagocytic cells. The morphology of the fixed phagocytes is described, and the phagocytic system of the snail is compared with that of other molluscan species. 相似文献
4.
The effects of lead (5 or 10 ppm) on the survival of the freshwater snail Lymnaea stagnalis (L.) collected from lead contaminated or uncontaminated environments were evaluated under controlled laboratory conditions.
The animals from the contaminated environment had significantly greater survivability than those from the unpolluted environment
to subsequent acute (up to 24 days) exposure to lead. Acute (72 h) exposure to lead inhibited several behavioural activities
including locomotion, feeding, tentacle extension and emergence from the shell. Lead bioaccumulated in the snail tissues,
especially the buccal mass and stomach. The freshwater snail provides a valuable system for studying the bioaccumulation and
development of tolerance to environmental lead.
Electronic Publication 相似文献
5.
6.
7.
A chronic intoxication with carbaryl, fenthion and lindane was induced in young snails. The parameter k of the von Bertalanffy's equation showed clearly the growth changes induced by these insecticides. In all cases the fecundity of intoxicated snails was reduced. Among these three insecticides, lindane was the most toxic, carbaryl the least. 相似文献
8.
Summary Electron micrographs of pore cells of Lymnaea stagnalis suggest that these cells produce and store haemocyanin. 相似文献
9.
The disturbance of plasma membrane carbohydrates and of lipopolysaccharide (LPS) ligands in relation to cytoskeletal transformations of haemocytes has been investigated after chronic exposure of pond snails (Lymnaea stagnalis) to the peroxidizing toxicant fomesafen. Neither of the two lectins used (concanavalin A and wheat germ agglutinin) showed any binding modification after incubation of the snails in the presence of the toxicant. However, after exposure of the snails to fomesafen, a clear and persistent reduction in LPS labelling of haemocytes occurred. The actin cytoskeleton of the same cells also appeared to be sensitive to the toxicant. The reduction in LPS-binding sites was related to actin staining, leading to the hypothesis that LPS ligands and actin could be similarly modulated by the toxicant. Damaged cells showed non-adherent membrane portions with reduced filopodial extrusions, exhibiting a smooth surface free of microvilli. These changes could lower the spreading and adhesion of the cells and could therefore account for the loss in their phagocytic capabilities. 相似文献
10.
Puurtinen M Hytönen M Knott KE Taskinen J Nissinen K Kaitala V 《Evolution; international journal of organic evolution》2004,58(12):2747-2753
The amount and distribution of genetic variability in host populations can have significant effects on the outcome of host-parasite interactions. We studied the effect of mating system and genetic variability on susceptibility of Lymnaea stagnalis snails to trematode parasites. Mating system of snails from eight populations differing in the amount of genetic variability was manipulated, and self- and cross-fertilized offspring were exposed to naturally occurring trematode parasites in a controlled lake experiment. Susceptibility of snails varied between populations, but mating-system treatment did not have a significant effect. Heterozygosity of snails was negatively correlated with the probability of trematode infection, however, suggesting that parasitic diseases may pose a serious threat to populations lacking genetic variability. 相似文献
11.
12.
13.
P L Hordijk H van Loenhout R H Ebberink M de Jong-Brink J Joosse 《The Journal of experimental zoology》1991,259(2):268-271
This study examines the interaction between the caudodorsal cell hormone (CDCH) and schistosomin, a peptide secreted by the central nervous system of the snail (Lymnaea stagnalis) infected with the avian schistosome Trichobilharzia ocellata. Non-infected snails were injected with synthetic as well as native CDCH in the absence or presence of purified schistosomin. The response to 2 pmol of synthetic CDCH was blocked for 90% by coinjection with 3.5 pmol of schistosomin. The ovulation-inducing activity of extracts of cerebral commissures (the storage area of native CDCH) was also blocked by schistosomin. The degree of inhibition (65%), however, was less than that observed with synthetic CDCH. These results show that schistosomin inhibits ovulation and egg laying in Lymnaea. This explains the decrease or absence of egg laying in schistosome-infected freshwater snails. 相似文献
14.
Marijke de Jong-Brink H. M. Koop W. F. de Roos J. M. Bergamin-Sassen 《Invertebrate reproduction & development.》2013,57(4):207-219
The secretory activity of the albumen gland of the freshwater snail Lymnaea stagnalis was studied morphometrically (both at the light- and at the electron-microscope level) and biochemically under the following experimental conditions: (1) glandular tissue was implanted into acceptor snails and the glandular activity of the implants was compared to that of the glands of the donors and acceptors; (2) glandular activity was measured at various periods after oviposition; and (3) the activity was measured during a 24 h cycle (diurnal activity). The results indicate that cellular release of secretion material is regulated by a nervous mechanism, whereas synthetic activity is under hormonal control. 相似文献
15.
The digestive gland of the freshwater snail Lymnaea stagnalis, exposed to water containing an elevated concentration of aluminium at neutral pH for up to 30 days, followed by a 20 day recovery period, was examined by light and electron microscopy and X-ray microanalysis. Aluminium was localized in the yellow granules present in the digestive and excretory cells and in the green and small granules present in the digestive cells. More aluminium, silicon, phosphorus and sulphur were present in all three granule types from aluminium exposed snails. The number of yellow and green granules from the digestive gland of aluminium exposed snails showed a progressive increase over the experimental period compared to controls. The number and aluminium content of the granules is likely to reflect the role of the digestive gland as a 'sink' for accumulated aluminium. We propose that intracellular monomeric silica is involved in the detoxification of aqueous aluminium which at neutral pH is largely in the form of an insoluble polyhydroxide. The increased amounts of sulphur and phosphorus in the granules are likely to be part of a broad response to metal loading but probably do not play a significant role in the storage and detoxification of aluminium. 相似文献
16.
D G Wright 《Canadian journal of zoology》1971,47(7):997-1000
17.
A novel molluscan insulin-related peptide (MIP) III, has been isolated from alcohol extracts of the neurohaemal area of the cerebral neuroendocrine light-green neurones of Lymnaea stagnalis. MIP III was purified by sequential high-performance gel-permeation chromatography followed by reverse-phase HPLC. MIP III is a heterodimer connected by disulphide bonds. Edman degradation analysis and subsequent alignment with the A and B chains of the previously identified MIP I and II showed that the 24-amino-acid peptide with the sequence pQSRPSIVC(E)CCFNQCTVQ(E)LLAYC represents the MIP III A chain, and the 37-amino-acid peptide sequence TTQHTCSILSRPHPRGLCGSTLANMVQWLCSTYTTSS the B chain. The overall amino acid sequence of MIP III shows about 50% similarity with those of MIP I and II, and only 20-40% similarity with other peptides of the insulin superfamily. Important structural features, e.g. disulphide bridges and the hydrophobic core, are conserved in MIP III. 相似文献
18.
Dr. Marijke de Jong-Brink Nico D. de With Peter J. M. Hurkmans Marion J. M. Bergamin Sassen 《Cell and tissue research》1984,235(3):593-600
Summary In the hermaphroditic pulmonate snail Lymnaea stagnalis a blood-gonad (blood-testis) barrier appears to exist. Septate junctions between Sertoli cells and epithelial cells of the neck areas of the gonadal acini constitute this barrier; they separate the male from the female compartment. Experiments with tracer substances (colloidal gold particles, lanthanum nitrate, tannic acid) showed that the basal lamina around the acini hardly forms a barrier; only the larger colloidal gold particles do not pass this lamina.Physiologically, the blood-gonad barrier is apparent in studies on the composition of gonadal fluid, which differs considerably from that of haemolymph. The osmolarity and the concentration of protein and amino acids in gonadal fluid exceed those of haemolymph. As to the major ions, in the gonadal fluid Na+ is partly replaced by K+, and HCO
3
-
is almost totally replaced by Cl-. Such a distribution of HCO
3
-
and Cl- is indicative of metabolic acidosis. The cytochemical localization of carbonic anhydrase activity in cells lining the acinar lumen (Sertoli cells, epithelial cells) suggests that these cells are involved in the process of ion exchange. The metabolic acidosis in the gonad might result from the anaerobic production of lactate and succinate by Sertoli cells; these cells lack the enzymes cytochrome oxidase, lactate dehydrogenase, and succinate dehydrogenase. Spermatogenic cells, on the other hand, do possess these enzymes. This probably indicates that these cells metabolize lactate and succinate secreted by Sertoli cells.The authors are greatly indebted to Prof. Dr. H.H. Boer for stimulating comments during this study, to Dr. C.J.F. van Noorden and Miss Ilse M.C. Vogels for localization of dehydrogenase activity; to Mr. R. van Elk for determining amino acids, and to Dr. W.P.W. van der Knaap for performing the agglutinin assay 相似文献
19.
N. I. Syed D. Harrison W. Winlow 《Journal of comparative physiology. A, Neuroethology, sensory, neural, and behavioral physiology》1991,169(5):541-555
Summary This study describes the neural basis of respiratory behavior in a pulmonate mollusc, Lymnaea stagnalis. We describe and identify muscles of the respiratory orifice (pneumostome) and mantle cavity as well as relevant motor neurons innervating these muscles. All of these identified motor neurons are active during spontaneously occurring respiratory behavior and a sporadically occurring synaptic input, termed Input 3, controls the activities of these motor neurons. This spontaneous input can also be recorded from isolated brain preparations, suggesting that the respiratory motor program is generated centrally. However, evidence is also presented that in semi-intact preparations the role of peripheral feedback is important for the initiation and termination of respiratory behavior in Lymnaea. 相似文献
20.
The main purpose of the studies presented in this paper is twofold: 1) to evaluate whether phyto-adaptogens (Acanthopanax senticosus and Rhodiola rosea) are able to exert a protective action against stress-induced death of embryos of the pond snail Lymnaea stagnalis; and 2) whether a possible protective action by phyto-adaptogens can be explained by the induction of heat shock proteins. Enhancement in resistance by phyto-adaptogens was studied by applying plant extracts for a period of 20 hours to 3-day old larvae of the pond snail Lymnaea stagnalis. Subsequently they were exposed to a high and toxic dose of different environmental stressors. The following stress conditions were selected: a physical stress condition (heat shock: 43 degrees C for 4 minutes), an oxidative stress condition (superoxide radicals induced by menadione (600 microM for 2 hours)) and heavy metal-induced stress (copper (150 microM for 1 hour) or cadmium (20 microM during 1 hour)). Both Acanthopanax and Rhodiola exert a strong protective action against a lethal heat shock. These adaptogens also significantly protect against the negative effect of superoxide radicals as induced by menadione. With respect to the protective action against exposure to heavy metals a small but significant protection was observed against intoxication with copper or cadmium by the phyto-adaptogens. In summary, there appears to be a difference in efficiency in enhancing resistance to the various stress conditions used (heat shock>menadione>copper>cadmium). Based on the results presented in this paper, we can conclude that phyto-adaptogens are able to enhance the resistance against the different stress conditions tested in developing individuals of Lymnaea. Although the degree to which resistance is enhanced appears to depend on the type of stressor applied, our results confirm the definition of phyto-adaptogens as being universal enhancers of non-specific resistance against different kinds of stress conditions. With respect to the mechanism of enhanced resistance, the question was asked whether this protective action is caused by an induction of heat shock proteins (hsps), which are known to be involved in tolerance and adaptation. The phyto-adaptogens did not induce the synthesis of any of the hsps, nor did they modulate the normal heat shock induced synthesis of these stress proteins. We conclude that it is unlikely that hsps play a major role in obtaining an enhanced state of resistance provided by phyto-adaptogens. 相似文献