Hydroprene prolongs developmental time and increases mortality of Indianmeal moth (Lepidoptera: Pyralidae) eggs

Eggs of the Indianmeal moth, Plodia interpunctella (Hübner), were exposed to the labeled rate of hydroprene (1.9 x 10(-3) mg [AI]/cm2) sprayed on concreted petri dishes. These eggs were exposed for 1, 3, 6, 12, and 18 h and until hatching (continuous exposure) at temperatures of 16, 20, 24, 28, and 32 degrees C and 57% RH until the emergence of first instars. The developmental time and egg mortality were significantly influenced by temperature and exposure periods. At 16 degrees C, hydroprene did not cause differences in developmental time when eggs were exposed for different periods. At temperatures >16 degrees C, both exposure period and temperature influenced developmental time. The maximum developmental time (15.0 +/- 0.2 d) occurred at 16 degrees C, and the minimum developmental time (3.2 +/- 0.3 d) occurred at 32 degrees C. Mortality increased when eggs were exposed to hydroprene for longer periods at all of the five tested temperatures. The greatest mortality (81.6 +/- 2.1%) occurred when eggs were continuously exposed on treated surfaces at 32 degrees C. We used developmental time instead of rate (1/ developmental time) to fit simple linear or polynomial regression models to the development data. Appropriate models for developmental time and mortality were chosen based upon lack-of-fit tests. The regression models can be used in predictive simulation models for the population dynamics of Indianmeal moth to aid in optimizing use of hydroprene for insect management.     

Relationship between supercooling point and mortality at low temperatures in Indianmeal moth (Lepidoptera: Pyralidae)

Indianmeal moth, Plodia interpunctella (Hübner), is classified as a freeze-intolerant organism and one of the most cold-tolerant stored-product pests. The objective of this study was to determine the relationship between mortality at low temperatures after minimum exposure and the supercooling point (SCP) for laboratory-reared P. interpunctella at different stages of development. This relationship also was analyzed for field-collected, cold-acclimated fifth instars. Mean SCP of laboratory-reared larvae (i.e., feeding stage) was consistently above approximately -16 degrees C. Mean SCP of laboratory-reared pupae and adults (i.e., nonfeeding stages) and field-collected, cold-acclimated fifth instars was consistently below approximately -21 degrees CP seemed to be the boundary between survival and death for larvae. However, it seemed that a 1-min exposure was not sufficient to cause larval mortality at the SCP. Alternatively, for both pupae and adults, the SCP seemed not to play an important role in their survival at low temperatures, with significant mortality observed at temperatures higher than the mean SCP. Adults were the most susceptible to low temperatures with no survival occurring at -20 degrees C, > 3 degrees C above its mean SCP. Results of this investigation demonstrate that P. interpunctella has a different response to low temperatures depending on stage of development and cold acclimation. Classifying P. interpunctella only as a freeze-intolerant organism disregards the occurrence of prefreeze mortality in this species. Therefore, a reclassification of this species (e.g., chill tolerant or chill susceptible) based on the extent of prefreeze mortality and the temperature and time of exposure at which it occurs is suggested.     

Evaluation of thiamethoxam and imidacloprid as seed treatments to control European corn borer and Indianmeal moth (Lepidoptera: Pyralidae) larvae

Efficacy of thiamethoxam (Cruiser) and imidacloprid (Gaucho) were evaluated as seed treatments for controlling European corn borer, Ostrinia nubilalis (Hübner) and Indianmeal moth, Plodia interpunctella (Hübner) larvae in stored grain. At approximately 22-26 degrees C, all fifth instar European corn borers died after two or 4 d of exposure to corn treated with 250 and 500 ppm thiamethoxam, respectively, while mortality of larvae exposed for two and 4 d on corn treated with 6.3-937.5 ppm imidacloprid did not exceed 48% at any concentration. At 29 degrees C, all nondiapausing fifth instars were killed after 3, 4, and 6-d exposure to 400, 300 and 200-ppm thiamethoxam, respectively, while survival increased at successively lower concentrations of 100, 50, 25, and 12.5 ppm. At 29 degrees C, the LC50 decreased from 85.9 to 7.2 ppm as the duration of exposure on treated corn increased from 2 to 6 d. All second and third instar Indianmeal moth larvae died after a 5 d exposure period to corn grain treated with thiamethoxam at 50 ppm or higher, but as the larvae aged, higher concentrations and longer exposure periods were required to give 100% mortality of each larval instar. Similar results were obtained when larval Indianmeal moths were exposed on corn treated with imidacloprid, or on sorghum treated with thiamethoxam. Mature wandering phase fifth instars were the most tolerant larval stage of the Indianmeal moth.     

Attractancy and toxicity of an attracticide for Indianmeal moth, Plodia interpunctella (Lepidoptera: Pyralidae)

Plodia interpunctella (Hübner) is a serious and widespread postharvest pest on cereal products, dried fruits, candy, and pet food. Due to the strong positive anemotactic flight response of P. interpunctella males to the main component of the female-produced pheromone [(Z,E)-9,12-tetradecadienyl acetate, herein referred to as ZETA], we evaluated the potential of an attracticide for this pest, in which ZETA as attractant was combined with permethrin as the killing agent. Two concentrations of ZETA [0.16 and 0.32% (wt:wt)] and five concentrations of permethrin [0, 3, 6, 12, and 18% (wt:wt)] were incorporated into Last Call gel (10 different permethrin:ZETA combinations). All attracticide gels were evaluated in a toxicity test, in which either the tip of a leg or an antenna of a virgin P. interpunctella male was touched < 3 s into a dot of attracticide gel. These males were subsequently transferred to jars with virgin females. The toxicity test showed that a brief and gentle contact of P. interpunctella males with attracticide gel containing 3-18% permethrin caused a significant reduction in mating and killed males moths within 24 h. A wind tunnel test was conducted to evaluate the flight responses of P. interpunctella males to the same 10 attracticide gels. Male moths displayed significantly higher levels of positive anemotactic flight and more males made contact with the attracticide gel when the ZETA concentration was 0.16% compared with 0.32%. P. interpunctella males showed no signs of repellency to permethrin concentrations within a range of 0-18% in the attracticide gel. Three densities of P. interpunctella pairs were released into small warehouse rooms, and we found that the attracticide gel suppressed oviposition when the moth density was at a low level, but it was ineffective when the moth density exceeded one male-female pair per 11.3 m3.     

Mortality of Indianmeal moth (Lepidoptera: Pyralidae) populations under fluctuating low temperatures: model development and validation

A model for predicting mortality of Indianmeal moth larvae [Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae)] under fluctuating low-temperature conditions was developed. The time and temperature combinations required to achieve 100% mortality of field-collected, cold-acclimated P. interpunctella larvae obtained from laboratory mortality experiments were used to develop the mortality model. Accumulation of mortality rate over time was called the cumulative lethality index (CLI). Complete mortality of insect populations would occur when CLI equals 1. Observed mortality of field-collected, cold-acclimated P. interpunctella larvae in five 76.2-T (3,000-bu) shelled corn bins located in Rosemount, MN, during the winters of 2003-2004 and 2004-2005 were used to validate the CLI model (i.e., mortality model). Excellent agreement between predicted and measured time to 100% larval mortality was observed. The CLI model would be useful for developing low-temperature aeration management strategies for controlling overwintering P. interpunctella in grain bins. In addition, this model will be useful when determining if additional control measures will be required as a result of above-seasonal ambient temperatures.     

Effects of height and adjacent surfaces on captures of Indianmeal moth (Lepidoptera: Pyralidae) in pheromone-baited traps

Diamond-shaped pheromone-baited traps are used widely in food storage and food processing facilities for monitoring of Plodia interpunctella (Hübner), and here we evaluated to what extent trap captures were affected by 1) vertical placement of traps, 2) deployment of a horizontal landing platform to the diamond-shaped pheromone trap, and 3) placement of traps either freely exposed or along a sidewall. In the small sheds (height 1.8 m), traps were placed in three heights and significantly highest trap captures were obtained near the ceiling. When the same experiment was conducted in a larger room (height 6 m) with traps at seven heights, highest captures were obtained at both the lowest and highest traps. In a subsequent experiment, we deployed a horizontal platform to traps at seven heights and found that the importance of vertical placement became less important. Thus, it seemed that male moths preferred to orient to a pheromone source associated with a physical surface, such as the floor, ceiling, or landing platform. In a comparison of P. interpunctella male trap captures in a completely dark room (no visual cues), traps with a landing platform caught significantly more than traps without the platform. In a final experiment, we evaluated the effect of hanging traps either freely or adjacent to sidewalls, and significantly highest trap captures were obtained along side-walls. The results presented here suggest that deployment of a horizontal platform reduces the importance of the vertical placement of traps and seems to increase the trap efficiency, and we recommend placement of traps along sidewalls and/or near the ground.     

Biological control of Indianmeal moth (Lepidoptera: Pyralidae) on finished stored products using egg and larval parasitoids

Biological control using hymenopteran parasitoids presents an attractive alternative to insecticides for reducing infestations and damage from the Indianmeal moth, Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae), in retail and warehouse environments. We examined the potential for using combinations of the egg parasitoid Trichogramma deion Riley (Hymenoptera: Trichogrammatidae), and the larval parasitoid Habrobracon hebetor (Say) (Hymenoptera: Braconidae) for preventing infestations of P. interpunctella in coarse-ground cornmeal as well as the influence of packaging on parasitoid effectiveness. Treatments included one or both parasitoids and either cornmeal infested with P. interpunctella eggs or eggs deposited on the surface of plastic bags containing cornmeal. H. hebetor had a significant impact on the number of live P. interpunctella, suppressing populations by approximately 71% in both unbagged and bagged cornmeal. In contrast, T. deion did not suppress P. interpunctella in unbagged cornmeal. However, when released on bagged cornmeal, T. deion significantly increased the level of pest suppression (87%) over bagging alone (15%). When H. hebetor was added to bagged cornmeal, there was a significant reduction of live P. interpunctella compared with the control (70.6%), with a further reduction observed when T. deion was added (96.7%). These findings suggest that, in most situations, a combined release of both T. deion and H. hebetor would have the greatest impact; because even though packaging may protect most of the stored products, there are usually areas in the storage landscape where poor sanitation is present.     

Ionizing irradiation of adults of Angoumois grain moth (Lepidoptera: Gelechiidae) and Indianmeal moth (Lepidoptera: Pyralidae) to prevent reproduction, and implications for a generic irradiation treatment for insects

Ionizing irradiation is used as a phytosanitary treatment against quarantine pests. A generic treatment of 400 Gy has been approved for commodities entering the United States against all insects except pupae and adults of Lepidoptera because some literature citations indicate that a few insects, namely, the Angoumois grain moth, Sitotroga cerealella (Olivier) (Lepidoptera: Gelechiidae), and the Indianmeal moth, Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae), are not completely controlled at that dose. Radiotolerance in insects increases as the insects develop, so the minimum absorbed dose to prevent F1 egg hatch for these two species when irradiated as adults was examined. Also, because hypoxia is known to increase radiotolerance in insects, Angoumois grain moth radiotolerance was tested in a hypoxic atmosphere. A dose range of 336-388 Gy prevented F1 egg hatch from a total of 22,083 adult Indianmeal moths. Dose ranges of 443-505 and 590-674 Gy, respectively, prevented F1 egg hatch from a total of 15,264 and 13,677 adult Angoumois grain moths irradiated in ambient and hypoxic atmospheres. A generic dose of 600 Gy for all insects in ambient atmospheres might be efficacious, although many fresh commodities may not tolerate it when applied on a commercial scale.     

Predation and avoidance of tough leaves by aquatic larvae of the moth Parapoynx rugosalis (Lepidoptera: Pyralidae)

Abstract.

• 1 Aquatic larvae of the pyralid moth Parapoynx rugosalis Möschler repeatedly construct protective cases by cutting portions (discs) from leaves of the waterlily Nymphaea ampla and sandwich themselves between the disc and the underside of the host leaf. Construction of a new case requires leaving the old case, thus increasing exposure to predators and parasites.
• 2 In an experiment, larvae with protective cases experienced no mortality due to predation by fish, whereas larvae without cases experienced substantial predation.
• 3 In a series of choice tests, larvae preferentially selected young, tender leaves over old, tough leaves for construction of cases, and larvae spent significantly less time completing their shelters when cutting discs from young, tender leaves.
• 4 A partial explanation of why larvae select young, tender leaves for construction of their protective shelters may be that exposure time to predators during construction is minimized.
• 5 The same mechanism linking preferences for tender leaves to reduced exposure to predators during construction may also apply to other insect herbivores exhibiting leaf-rolling or case-building behaviour.

     

Impact of ant predation and heat on carob moth (Lepidoptera: Pyralidae) mortality in California date gardens

Dates, Phoenix dactylifera L., undergo a natural fruit abscission during the summer in California date gardens. Many of the abscised dates become lodged in the date bunch, and we demonstrated that carob moth, Ectomyelois ceratoniae (Zeller), prefer to use these dates as a reproduction host compared with dates that fall to the ground. We also found that abscised fruit shaken onto the ground had significantly fewer live carob moth larvae than fruit that remained in bunches in the tree. Mortality in the dropped fruit was attributed to predation by two native ant species, the fire ant Solenopsis aurea Wheeler, and the California harvester ant, Pogonomyrmex californicus (Buckley), in concert with extreme summer ground temperatures. Dates that fell in the full sunlight rapidly increased in temperature, which resulted in larvae either exiting the fruit (exposing them to ants) or dying in the fruit. Removal of abscised dates from bunches may provide a possible management strategy for carob moths in California date gardens.     

Life history attributes of Indian meal moth (Lepidoptera: Pyralidae) and Angoumois grain moth (Lepidoptera: Gelechiidae) reared on transgenic corn kernels

The Indian meal moth, Plodia interpunctella (Hübner), and Angoumois grain moth, Sitotroga cerealella (Olivier), are two globally distributed stored-grain pests. Laboratory experiments were conducted to examine the impact that corn (Zea mays L.) kernels (i.e., grain) of some Bacillus thuringiensis Berliner (Bt) corn hybrids containing CrylAb Bt delta-endotoxin have on life history attributes of Indian meal moth and Angoumois grain moth. Stored grain is at risk to damage from Indian meal moth and Angoumois grain moth; therefore, Bt corn may provide a means of protecting this commodity from damage. Thus, the objective of this research was to quantify the effects of transgenic corn seed containing CrylAb delta-endotoxin on Indian meal moth and Angoumois grain moth survival, fecundity, and duration of development. Experiments with Bt grain, non-Bt isolines, and non-Bt grain were conducted in environmental chambers at 27 +/- 1 degrees C and > or = 60% RH in continuous dark. Fifty eggs were placed in ventilated pint jars containing 170 g of cracked or whole corn for the Indian meal moth and Angoumois grain moth, respectively. Emergence and fecundity were observed for 5 wk. Emergence and fecundity of Indian meal moth and emergence of Angoumois grain moth were significantly lower for individuals reared on P33V08 and N6800Bt, MON 810 and Bt-11 transformed hybrids, respectively, than on their non-Bt transformed isolines. Longer developmental times were observed for Indian meal moth reared on P33V08 and N6800Bt than their non-Bt-transformed isolines. These results indicate that MON 810 and Bt-11 CrylAb delta-endotoxin-containing kernels reduce laboratory populations of Indian meal moth and Angoumois grain moth. Thus, storing Bt-transformed grain is a management tactic that warrants bin scale testing and may effectively reduce Indian meal moth and Angoumois grain moth populations in grain without application of synthetic chemicals or pesticides.     

Survival of indianmeal moth and navel orangeworm (Lepidoptera: Pyralidae) at low temperatures

Concerns over insect resistance, regulatory action, and the needs of organic processors have generated renewed interest in developing nonchemical alternative postharvest treatments to fumigants used on dried fruits and nuts. Low-temperature storage has been identified as one alternative for the Indianmeal moth, Plodia interpunctella (Hiibner), and navel orangeworm, Amyelois transitella (Walker) (Lepidoptera: Pyralidae), common postharvest pests in California dried fruits and nuts. The response of eggs, nondiapausing larvae, and pupae of both species to exposure to low temperatures (0, 5, and 10 degrees C) was evaluated. Eggs of both species were the least tolerant of low temperatures. At 0 and 5 degrees C, pupae were most tolerant, but at 10 degrees C, nondiapausing larvae of both species were most tolerant, with lethal time (LT)95 values of 127 and 100 d for Indianmeal moth and navel orangeworm, respectively. The response of diapausing Indianmeal moth larvae to subfreezing temperatures also was evaluated. Diapausing larvae were very cold tolerant at -10 degrees C, with LT95 values of 20 and 17 d for long-term laboratory and recently isolated cultures, respectively. Diapausing larvae were far less tolerant at lower temperatures. At -15 degrees C, LT95 values for both cultures were <23 h, and at -20 degrees C, LT95 values were <7 h. Refrigeration temperatures of 0-5 degrees C should be useful in disinfesting product contaminated with nondiapausing insects, with storage times of 3 wk needed for adequate control. Relatively brief storage in commercial freezers, provided that the temperature throughout the product was below -15 degrees C for at least 48 h, also shows potential as a disinfestation treatment, and it is necessary when diapausing Indianmeal moth larvae are present.     

Cocoon-spinning larvae of Oriental fruit moth and Indianmeal moth do not produce aggregation pheromone

1 Mature larvae of the Oriental fruit moth (OFM) Grapholita molesta (Lepidoptera: Tortricidae) and the Indianmeal moth (IMM) Plodia interpunctella (Lepidoptera: Pyralidae) leave their food source in search of suitable pupation sites in which to spin cocoons. These sites are typically well-concealed cracks and crevices within the environment. Such cocooning behaviour is also observed in larvae of the codling moth (CM) Cydia pomonella (Lepidoptera: Tortricidae), which aggregate prior to pupation in response to a pheromone blend produced by cocoon-spinning conspecific larvae.
2 In laboratory experiments, we tested whether cocoon-spinning OFM and IMM larvae produce aggregation pheromones and whether CM larvae are cross-attracted to closely-related OFM larvae.
3 Fifth-instar OFM and IMM larvae were not attracted to, or arrested by, cocoon-spinning conspecifics. Moreover, fifth-instar CM larvae were not cross-attracted to either cocoon-spinning OFM or IMM larvae.
4 Analyses of volatiles released from cocoon-spinning OFM and IMM larvae revealed that both OFM and IMM lack components that are present in the aggregation pheromone of CM larvae. This information may help explain why CM larvae are not cross-attracted to cocooning OFM or IMM larvae.     

Microencapsulated pear ester enhances insecticide efficacy in walnuts for codling moth (Lepidoptera: Tortricidae) and navel orangeworm (Lepidoptera: Pyralidae)

The efficacy of combining insecticides with a microencapsulated formulation of ethyl (2E,4Z) -2,4-decadienoate (pear ester, PE-MEC) was evaluated in walnuts, Juglans regia L., for codling moth, Cydia pomonella (L.) (Lepidoptera: Tortricidae), and navel orangeworm, Amyelois transitella Walker (Lepidoptera, Pyralidae). Two types of studies were conducted to compare the use of insecticides with and without PE-MEC. In the first study, PE-MEC in combination with reduced rates of insecticides, including chlorpyrifos, phosmet, methoxyfenozide, and codling moth granulovirus were evaluated in single tree replicates. PE-MEC was tested at one to three rates (0.6, 1.8, and 4.4 g active ingredient ha(-1)) with each insecticide. In the second study, seasonal programs including sprays of esfenvalerate, chlorpyrifos, and ethyl parathion at full rates were evaluated in replicated two ha blocks. Significant reductions in nut injury occurred in the single-tree trial with treatments of PE-MEC plus insecticide compared with the insecticides used alone against both pest species; except with methoxyfenozide for navel orangeworm. Similarly, nut injury in the large plots was significantly reduced with the addition of PE-MEC, except for navel orangeworm in one of the two studies. These results suggest that adding pear ester as a microencapsulated spray can improve the efficacy of a range of insecticides for two key pests and foster the development of integrated pest management tactics with reduced insecticide use in walnut.     

Comparative mortality of diapausing and nondiapausing larvae of Plodia interpunctella (Lepidoptera: Pyralidae) exposed to monoterpenoids and low pressure

Monoterpenoids and low pressure have each been demonstrated to cause mortality of stored-product insect pests. The current report investigated the prospects of integrating the two methods in the management of diapausing and nondiapausing larvae of Plodia interpunctella (Hübner). In a separate experiment, the larvae were exposed to 35.5 mmHg in Erlenmeyer flasks at 19 and 28 degrees C for times ranging from 30 min to 96 h. Another set of experiments was conducted to investigate the toxicity of exposing P. interpunctella larvae to monoterpenoids including E-anethole, estragole, S-carvone, linalool, L-fenchone, geraniol, gamma-terpinene, and DL-camphor alone or in combination with low pressure (50 mmHg). Lethal times (LT) determined by subjecting time-mortality data to probit analyses were shortened to half when both diapausing and nondiapausing larvae were exposed to low pressure at 28 degrees C compared with 19 degrees C. Exposure of diapausing larvae to a monoterpenoid alone, with the exception of DL-camphor and estragole, at a concentration of 66.7 microl/1L of volume required > 30 h to generate 99% mortality at 19.0 +/- 0.8 degrees C. However, the LT99 values for diapausing and nondiapausing larvae exposed to combinations of DL-camphor or estragole and low pressure were considerably shortened. Combinations involving the rest of the monoterpenoids investigated and low pressure did not generate LT99 that were shorter than those of the control, which was low pressure only. These results suggest that integrating low pressure with DL-camphor or estragole could be a new method for the control of diapausing larvae of P. interpunctella at cooler temperatures.     

Comparing the effects of the exotic cactus-feeding moth, Cactoblastis cactorum (Berg) (Lepidoptera: Pyralidae) and the native cactus-feeding moth, Melitara prodenialis (Walker) (Lepidoptera: Pyralidae) on two species of Florida Opuntia

This study examined the effects of the native cactus moth borer, Melitara prodenialis, and the invasive cactus moth borer, Cactoblastis cactorum, on two common cactus species, Opuntia stricta and O. humifusa at coastal and inland locations in central Florida. Opuntia stricta were present only at coastal sites and O. humifusa were present at coastal and inland sites. Throughout the duration of the study, coastal plants were subject to damage solely by C. cactorum and inland plants solely by M. prodenialis. Results showed marginally significantly higher numbers of eggsticks on O. stricta than O. humifusa and significantly higher numbers at coastal sites than at inland sites. There was also significantly higher moth damage on O. stricta than O. humifusa and at coastal sites than inland sites, but not significantly so. However, there was a higher level of plant mortality for O. humifusa than for O. stricta and a significantly higher level of cactus mortality at inland sites when compared to coastal sites. This increased mortality may be due to increased attack by true bugs, Chelinidea vittiger, and by Dactylopius sp., combined with attack by M. prodenialis. Inland plants also tended to be smaller than coastal plants and could be more susceptible to the combined effects of all insects. Further long-term research on coastal cactus survival when attacked and unattacked by Cactoblastis is necessary to fully determine the effects of this moth on Opuntia survival.     

Impact of modified atmospheres on respiration of last instar larvae of the rice moth,Corcyra cephalonica (Lepidoptera: Pyralidae)

Abstract

Effect of modified atmospheres (MAs) containing CO₂ at 20, 40, 60 and 80% or containing N₂ at 97 and 98% on the mortality of Corcyra cephalonica Stainton (Lepidoptera: Pyralidae) sixth instar larvae was studied to determine the LT values at 30?°C. The respiration rates of untreated and treated larvae with 60% CO₂ and/or 98% N₂ at LT₅₀ were measured using Q-Box RP1LP low range respirometry package. Total protein and triglycerides of treated and untreated larvae were assayed. Complete larval mortality was recorded after 72 and 144?h of treatment with 60% CO₂ and 98% N₂, respectively. Calculated LT₅₀ values were 39.3 at 60% CO₂ and 87.5?h at 98% N₂ MAs. Respiration quotient (RQ) in the light of consumed O₂ and produced CO₂ of untreated larvae was 1.0 while it was 0.85 at 60% CO₂ and 0.72 at 98% N₂. Duration time necessary for produced CO₂ curve to reach the maximum point (2000?ppm) was significantly shorter at untreated larvae (27.64?min) in comparison with that recorded at CO₂ (35.48?min) which also significantly less than that obtained at N₂ (98.54?min). At all treatments, total protein was decreased while triglycerides were increased in comparison with control.     

Purification and characterization of hemolymph prophenoloxidase from Ostrinia furnacalis (Lepidoptera: Pyralidae) larvae

Prophenoloxidase (PPO) was isolated from the hemolymph of Ostrinia furnacalis larvae and purified to homogeneity. A 369.85-fold purification and 35.34% recovery of activity were achieved by employing ammonium sulfate precipitation, Blue Sepharose CL-6B chromatography and Phenyl Sepharose CL-4B chromatography. The purified enzyme exhibits a band with a molecular mass of 158 kDa on native PAGE and two spots with a molecular mass of 80 kDa and a pI of 5.70, and a molecular mass of 78 kDa and a pI of 6.50, respectively, on two-dimensional gel electrophoresis. The N-terminal amino acid sequences of two subunits are as follows: PPO1, FGEEPGVQTTELKPLANPPQFRRASQLPRD; PPO2, FGDDAGERIPLQNLSQVPQFRVPSQLPTD. The amino acid composition of purified PPO was similar to that from Galleria mellonella. The enzyme kinetic property of the purified protein showed that the affinity of the enzyme for dopamine was higher than that for l-DOPA and N-acetyldopamine. The phenoloxidase (PO) reaction was strongly inhibited by phenylthiourea, thiourea, dithiothreitol and ethylene diamine tetraacetic acid (EDTA), but poorly inhibited by diethyldithiocarbamate (DTC) and triethylenetetramine hexaacetic acid (THAA), and was not inhibited by o-phenanthroline and ethylene glycol-bis (beta-aminoethylether) N,N,N',N'-tetraacetic acid (EGTA). Both Mg(2+) and Cu(2+) stimulated PO activity when compared with controls. The beta-sheet content of PPO treated with Mg(2+) and Cu(2+) increased significantly (P<0.05). The purified PPO has magnesium level of 5.674+/-2.294 microg/mg and copper level of 1.257+/-0.921 microg/mg as determined with ICP-MS, suggesting that the purified PPO is a metalloprotein.     

水生鳞翅类——螟蛾科水螟亚科

从成虫、卵、幼虫、蛹及生物学等方面介绍了鳞翅目的主要水生类群———螟蛾科水螟亚科Nymphulinae的主要特征及其幼虫的主要生活类型。水螟幼虫的生活型可分为Nymphula型、Parapoynx型、Potamomusa型、Eoophyla型和Nymphicula型。各生活型的主要类群及生活特征也予以说明。目的是为了使读者对该类群有正确的认识,以引起人们的重视。     

Influence of host plant stages on carob moth (Lepidoptera: Pyralidae) development and fitness

Different generations of the carob moth, Ectomyelois ceratoniae (Zeller), use different date, Phoenix dactylifera L., fruit stages as they become available during the summer months in southern California. These are the kimri, khalal, and tamar fruit stages. This study was conducted to determine whether carob moth development and fitness were affected by these different fruit stages. Developmental time from neonate larvae to adult, when reared at 31.9 degrees C and 82.1% RH, ranged from 30.5 to 32.3 d for females and 27.1 to 29.5 d for males on the different field-collected fruit stages. Males and females had the highest emergent weight when reared as larvae on kimri fruit and the lowest on tamar fruit. Females laid the most eggs when reared on kimri fruit and the least when reared on tamar fruit. Estimates of population doubling times ranged from 5.4 d on artificial diet (included as a control) to 7.5 d on tamar fruit. This short doubling time shows the ability of carob moth to develop rapidly under optimal conditions. Degree-day (DD) estimates for carob moth development ranged from 636 DD on kimri fruit to 658 DD on tamar fruit, which translate to 32-50 d under field temperatures in the area where dates are grown. Potential implications for field management of E. ceratoniae include improved timing of insecticide treatments to limit population growth early in the season rather than the conventional late season approach.