A Preliminary Investigation on the Status of the Wildlife Trade in Guangxi,China

1IntroductionWildlifetradeisamain~mpetustoutilizewildlife.Thechangeinspeciesandvolumein-volvedinthewildlifetrademayreflectconservationstatus,dynamicsandexploitedlevelofwildliferesources.Thestudyonwildlifetradeisthetheoriticalbasisonwhichproposalsastolimittradeonrareorendangeredspeciescanbemade,andwithwhichfuturemonitoringofthetradecanbecompared.Theresultalsocanbeusedtoevaluateconservationeffectsofprotectionmeasuresandlawsforbiodiversityconservation.Itisofgreatsignificanceinguid-ingsustainable…     

A new subgenus and species of Alloscorpiops Vachon, 1980 from Laos (Scorpiones,Euscorpiidae, Scorpiopinae); implications for the taxonomy of the group

Alloscorpiops (Laoscorpiops) calmonti subgen. n., sp. n., belonging to the family Euscorpiidae Laurie, is described on the basis of single female specimen collected in the Pathoumphone District of southern Laos. This new scorpion taxon may represent yet another endemic element for the fauna of Laos. The new subgenus is characterized by a previously unknown and possible unique trichobothrial pattern.     

Parachorius semsanganus sp. n. (Coleoptera, Scarabaeidae, Scarabaeinae) from Laos and its significance in the phylogeny of Oriental Deltochilini

The new species Parachorius semsanganussp. n. is described from Laos. This enigmatic Oriental deltochiline represents a "morphological link" between Parachorius and Cassolus by sharing characters of the two genera. The fact that Parachorius semsanganus cannot be unequivocally placed in either of these two genera stresses some more general problems of the current classification of Parachorius and Cassolus. Such problems can be solved only in the course of phylogenetic analysis, the need of which is briefly outlined.     

Drakensbergianella rudebecki, New Genus and New Species from the Mountains of Southern Africa, and Taxonomic Observations on Gabonia Jacoby and Related Genera (Insecta, Coleoptera, Chrysomelidae, Alticinae)

Drakensbergianella rudebecki, a new genus and new species of flea beetle (Chrysomelidae, Alticinae) found at high elevations from Southern Africa (Drakensberg mountains) is described. This new genus is closely related to the genus Gabonia Jacoby, 1893 but is easily distinguishable mainly by: the metasternum shorter than the length of the middle coxal cavities; the legs with femora and tibiae clearly elongate, especially the hind ones; the antennae generally longer than body in both sexes, especially in males; the metafemoral spring with inner side of the ventral lobe not angled; the metathoracic wings strongly reduced. Line drawings of male and female genitalia, metafemoral springs, and scanning electronic micrographs of particular morphological aspects of the taxa considered are provided. Finally, a brief discussion about Gabonia and related genera in the Afrotropical region with a key for the identification, is also reported. Moreover, the following new combination is proposed: Longitarsus ruandensis Weise, 1910 = Montiaphthona ruandensis Weise, 1910 n. comb.     

Observations on the in vitro formation, development and differentiation of trilaminar vesicles formed from enzymatically dispersed porcine blastocysts

The formation of trophoblastic vesicles and their use as a model for cell-to-cell interactions in the embryonic development of the mouse have been extensively studied both in vitro and in vivo . In this report, we describe the formation of trilaminar vesicles in vitro from enzymatically dispersed porcine blastocysts. Trilaminar vesicles were generated from single cell suspensions of enzymatically dispersed porcine blastocysts recovered 12 through 15 days post-breeding. Blastocysts at 10 and 11 days of development failed to form TV. No preference for self-aggregation was apparent as evident by the formation of vesicles containing cells from two different blastocysts origins. Two distinct morphological types of vesicles were formed: vesicles that displayed complete homogeneity in cell density and vesicles that had a small area of greater cell density resembling the embryonic disc. Some TV displayed localized areas of nucleated eosinophilic cells within the mesenchymal layer of the trilaminar membrane. In rare instances (2%) TV displayed contractility associated with a raised area of cells on the outer surface of the membrane. The cells comprising this contractile region were positive for Ca(++)-activated myofibriliary ATPase acitivity. Transfer of TV to the uterine horn of a gilt failed to delay a return to estrus. Transfer of TV to the uterine horn of pseudopregnant rabbits induced a localized inflammation and infiltration of leukocytes three days after transfer but no inflammation was evident at 9 or 16 days post-transfer.     

Observations on the distribution patterns,behaviour, diets and reproductive cycles of sand-dwelling clinids (Perciformes: Clinidae) from South Africa

Synopsis Twenty-two samples of sand-dwelling fishes were collected from sublittoral sandy substrata off the Cape Peninsula, South Africa using a novel quantitative technique in which the ichthyocide, rotenone, was introduced beneath 6.25 m² plastic sheets weighted around the perimeter with chain. A total of 94 fish of eight species and four families were recorded. Of these, four species of the family Clinidae made up 92% of the material. Fish densities varied from 0.10–2.96 fish m^–2 (0.17–1.14 g m^–2). Distribution patterns amongst the Clinidae were explained by sediment particle size, with all of the newly discovered species, Cancelloxus longior, inhabiting fine sand (median grain size 0.25–0.50 mm), and all Xenopoclinus leprosus, C. elongatus and Pavoclinus smalei occurring in gravel (> 1 mm). Xenopoclinus kochi was found in all sediment types, but was most abundant in coarse substrata. Diets of all four species were similar, consisting chiefly of amphipods and isopods. However, small differences in prey preference were evident. All four species reached sexual maturity at 25–30 mm standard length, were viviparous, exhibited superembryonation and gave birth to live young of approximately 14 mm. Breeding seasonality occurred in all species except P. smalei.     

Taxonomic Notes on Nasutitermes and Bulbitermes (Termitidae, Nasutitermitinae) from the Sunda region of Southeast Asia based on morphological and molecular characters

The Sunda region of Southeastern Asia is rich in termite fauna, but termites from this region have been poorly described. In this study, we described eight species from two diverse genera from this region, and from the family Termitidae. We describe Bulbitermes 4 spp. and Nasutitermes 4 spp. from new field collections. Where possible we examine original holotype specimens, and describe the essential morphological characters for soldier and worker castes. We devise two new bifurcating keys to guide the field identification of each species. In addition, we develop a nucleotide sequence profile for the COI gene. From this molecular character matrix, we use Neighbour-Joining analysis to test the monophyly of each morphospecies and genus. We find that the morphological and molecular characters are highly concordant, whereby all taxa appear to represent distinct molecular clades. For termites, there is therefore agreement between the morphological taxonomic characters used to sort species from a bifurcating key and the molecular taxonomic characters used to sort species on a bifurcating tree. This joint analysis suggests that DNA barcoding holds considerable promise for termite taxonomy, especially for diverse clades like Bulbitermes and Nasutitermes for which a global morphological key would be intractable.     

Observations on the structure of epidermal cells, particularly the cork and silica cells, from the flowering stem internode of Lolium temulentum L. (Gramineae)

Features of the epidermis such as stomata, hairs, cork and silica cells are described from both light and electron microscope studies. The stomatal complex consists of two guard cells and two subsidiary cells. After division of the guard mother cell a pore is left at each end of the dividing wall. The cork and silica cells arise from a single another cell and develop differentially. The silica cell enlarges more than the cork cell and finally becomes filled with solidified silica. The outer tangential and radial walls of the cork cells become very thick-walled, whereas the inner tangential and radial walls of the silica cells become thickened. The outer tangential wall of the silica cell remains thin and is covered with a thin layer- of cuticle. This wall frequently collapses in old cells leaving a depression in the surface of the stem. The change in the ultrastructure of the cork and silica cells are described and the possible functions of these cells discussed.     

Notes on black elytron species of Pyrrhalta Joannis and the description of a new species from China (Coleoptera,Chrysomelidae, Galerucinae)

Thirteen species of Pyrrhalta Joannis, 1865 with black elytron are reviewed. A key to species, photographs of aedeagus and habitus are provided. Pyrrhalta qianana sp. n. is described from Guizhou, China. Pyrrhalta martensi Medvedev & Sprecher-Uebersax, 1999 is newly recorded from China (Tibet).     

Notes on the species of Naarda Walker, 1866 (Lepidoptera: Erebidae,Hypeninae) from mainland China,with the description of a new species and establishment of a new synonymy

The species Naarda postpallida de Joannis, 1929 is reported for the first time from mainland China. Naarda pectinata Sugi, 1982 is synonymised with N. postpallida on the basis of material from Vietnam. This species can immediately be recognised by its dark grey forewing, white hindwing and several genital characters. The female genitalia of N. postpallida, together with those of N. lingualis Tóth and Ronkay, 2015 are presented for the first time. Naarda macrostigma sp. n. is described. The hitherto known nine Chinese Naarda species are listed. With nineteen figures.www.zoobank.org/urn:lsid:zoobank.org:pub:092AE905-08AA-4818-BDA8-2B9EF150793A     

Status of the South American tuberous legume Pachyrhizus tuberosus (Lam.) Spreng.: Field observations, taxonomic analysis, linguistic studies and agronomic data on the diversity of the South American Pachyrhizus tuberosus (Lam.) Spreng. complex with special reference to the identification of two new cultivar groups from Ecuador and Peru

The tuberous legume Pachyrhizus tuberosus is found in cultivation sporadically throughout the tropical lowlands of South America. As a result of field studies conducted in Bolivia, Ecuador, Peru and Venezuela, three distinct cultivar groups have been identified. Rare references presenting further evidence in support of this grouping, and yielding information on the cultivation history, are reviewed. The differences in morphology, agricultural practices, tuberous root quality and uses have been studied, as has the linguistic evidence of the origin and domestication processes. The herbarium and live material have been subjected to multivariate analyses in order to establish which easily observable phenotypic characters can be used in the identification of the three cultivar groups. This paper reports on the analysis of 23 morphological characteristics from 31 P. tuberosus cultivar records. The considerable potential of this cultivar/landrace complex and the possibilities of establishing in situ conservation initiatives are discussed. This revised version was published online in August 2006 with corrections to the Cover Date.