Untersuchungen über die Membran-Proteine bei Rhodospirillum rubrum

Zusammenfassung Membranen aus aeroben Dunkelkulturen von Rhodospirillum rubrum und Thylakoide wurden nach Behandlung mit Phenol-Harnstoff-Eisessig (2:1,2:1, w/w/v) in ihre Proteinbausteine zerlegt und durch Gelelektrophorese in Polyacrylamid getrennt. Die Muster der Proteinkomponenten beider Membransysteme unterschieden sich nur geringfügig. Eine dem mitochondrialen Struktur-protein entsprechende Fraktion wurde aus Thylakoiden isoliert. Nach Aufspaltung dieser Fraktion mit Phenol-Harnstoff-Eisessig und anschließender Elektrophorese konnten verschiedene Proteine in ihr festgestelt werden. Diese Proteine waren sämtlich in 8 M Harnstoff löslich. Die Folgerungen aus diesen Ergebnissen für den Membranaufbau bei Rhodospirillum rubrum werden diskutiert.

---

Investigations on membrane proteins in Rhodospirillum rubrum

Summary Membrane fractions from aerobically dark-grown Rhodospirillum rubrum and chromatophores (=thylakoids) were split into their protein subunits by phenol-urea-acetic acid (2:1.2:1, w/w/v) and separated by polyacrylamide gel electrophoresis. The spectra of the proteins of both types of membranes differed only slightly. A fraction was isolated from chromatophores (=thylakoids) by the methods for the homogeneous mitochondrial structural protein. When this fraction was split by phenol-urea-acetic acid and separated by gel electrophoresis several proteins could be identified. All of these proteins were soluble in 8 M urea. The consequences of these findings are discussed with respect to the composition of membranes in Rhodospirillum rubrum.

     

Nitrogen fixation by photosynthetic bacteria

In 1949, Howard Gest and Martin Kamen published two brief papers in Science that changed our perceptions about the metabolic capabilities of photosynthetic bacteria. Their discovery of photoproduction of hydrogen and the ability of Rhodospirillum rubrum to fix nitrogen led to a greater understanding of both processes. This revised version was published online in June 2006 with corrections to the Cover Date.     

Some observations on the culture,physiology and morphology of some brown-redRhodospirillum-species

Summary From ditch- and canalwater 21 strains of brown-red, photo-synthetically active spirilla were isolated. These spirilla distinguished themselves fromRhodospirillum rubrum by the composition of their pigment complex and by their behaviour towards oxygen (strictly anaerobic). The strains, judged by morphological characteristics, represented three different species. Two of the species could be identified withRhodospirillum fulvum van Niel resp.Rhodospirillum photometricum Molisch. The third species was found to be a new one, for which the nameRhodospirillum Molischianum was proposed.Regarding the isolation, culture, morphological and physiological characteristics of these organisms detailed data were given. Various organic substances can function as H-donors for these spirilla. The absorption spectra of living cells of the three species show a striking conformity, but there is a distinct difference between the absorption spectra of the brown-redRhodospirillum-species and the absorption spectrum ofRhodospirillum rubrum. The results of a chromatographical analysis of the pigment complex of one of the strains ofRhodospirillum pholometricum make it probable that this difference is due to the absence of the carotenoid spirilloxanthin in the brown-red spirilla.     

A bifunctional salvage pathway for two distinct S-adenosylmethionine by-products that is widespread in bacteria,including pathogenic Escherichia coli

S-adenosyl-l -methionine (SAM) is a necessary cosubstrate for numerous essential enzymatic reactions including protein and nucleotide methylations, secondary metabolite synthesis and radical-mediated processes. Radical SAM enzymes produce 5ʹ-deoxyadenosine, and SAM-dependent enzymes for polyamine, neurotransmitter and quorum sensing compound synthesis produce 5ʹ-methylthioadenosine as by-products. Both are inhibitory and must be addressed by all cells. This work establishes a bifunctional oxygen-independent salvage pathway for 5ʹ-deoxyadenosine and 5ʹ-methylthioadenosine in both Rhodospirillum rubrum and Extraintestinal Pathogenic Escherichia coli. Homologous genes for this pathway are widespread in bacteria, notably pathogenic strains within several families. A phosphorylase (Rhodospirillum rubrum) or separate nucleoside and kinase (Escherichia coli) followed by an isomerase and aldolase sequentially function to salvage these two wasteful and inhibitory compounds into adenine, dihydroxyacetone phosphate and acetaldehyde or (2-methylthio)acetaldehyde during both aerobic and anaerobic growth. Both SAM by-products are metabolized with equal affinity during aerobic and anaerobic growth conditions, suggesting that the dual-purpose salvage pathway plays a central role in numerous environments, notably the human body during infection. Our newly discovered bifunctional oxygen-independent pathway, widespread in bacteria, salvages at least two by-products of SAM-dependent enzymes for carbon and sulfur salvage, contributing to cell growth.     

Die Fettsäuren in ganzen Zellen,Thylakoiden und Lipopolysacchariden von Rhodospirillum rubrum und Rhodopseudomonas capsulata

Zusammenfassung Die photosynthetischen Bakterien Rhodospirillum rubrum und Rhodopseudomonas capsulata wurden auf ihre Fettsäurezusammensetzung untersucht. Die Hauptfettsäuren von R. rubrum waren C_16:0 (11%), C_16:1 (30%) und C_18:1 (52%). Vaccensäure (C_18:1) bildete 94% der Fettsäuren von Rps. capsulata. Anaerobe Lichtzellen (thylakoidhaltig) unterschieden sich nicht in ihrem Fettsäuremuster von aeroben Dunkelzellen (thylakoidfrei). Gereinigte Thylakoide aus Lichtzellen zeigten das gleiche Fettsäuremuster wie die ganzen Zellen.Nach Phenol/Wasser-Extraktion der ganzen Zellen bei 68° C war bei beiden Organismen sowohl aus Licht- als auch aus Dunkelzellen eine Substanz aus der gäßrigen Phase isolierbar, welche in den Sedimentationseigenschaften mit den Lipopolysacchariden der Enterobacteriaceae übereinstimmte und nach orientierenden Untersuchungen Zucker enthält. Aus ihr wurde ein Fettsäuregemisch gewonnen, dessen Zusammensetzung von dem aus ganzen Zellen erheblich abwich. In Rps. capsulata enthielt es C_12:1 (40%) und C_16:0 (50%), während in R. rubrum sich das Fettsäuremuster über den Bereich von C₁₀ bis C₂₀ erstreckte. Licht- und Dunkelzellen wiesen in dieser Substanz Unterschiede in der Fettsäurezusammensetzung auf. Der quantitative Anteil der Fettsäuren in dieser Substanz, bezogen auf die Gesamtfettsäuren der Zelle, betrug in Licht- und Dunkelzellen 5–7%. Hydroxy-myristinsäure ließ sich in beiden Organismen nicht nachweisen.

---

Fatty acid composition of whole cells, thylakoids and lipopolysaccharides of Rhodospirillum rubrum and Rhodopseudomonas capsulata

Summary The fatty acid composition of the photosynthetic bacteria Rhodospirillum rubrum and Rhodopseudomonas capsulata was investigated. The bulk of fatty acids of R. rubrum consisted of C_16:0 (11%), C_16:1 (30%), and C_18:1 (52%). The major fatty acid of Rps. capsulata was vaccenic acid (C_18:1), which accounted for 94% of the total fatty acids. Cells of both organisms, which were grown anaerobically in the light and fitted out with thylakoids had the same fatty acid composition as cells grown aerobically in the dark, which have no thylakoids.Purified thylakoids had the same fatty acid pattern as whole cells. Whole cells of light and dark cultures were extracted with phenol/water at 68° C. An opalizing fraction in the aqueous phase was sedimentable in the ultracentrifuge like the lipopolysaccharides of the Enterobacteriaceae. The pattern of fatty acids in this compound differed considerably from that of whole cells. The major fatty acids in this macromolecular fraction were C_12:1 (40%) and C_16:0 (50%) in Rps. capsulata, whereas in R. rubrum the whole range of fatty acids from C₁₀ to C₂₀ was demonstrable. Light and dark grown cells differed in the fatty acid composition of that compound. The fatty acid content of the extracted fraction accounted for 5–7% of the total fatty acids of whole cells. No hydroxymyristic acid could be identified in either R. rubrum or Rps. capsulata.

     

Die Alkoholkomponente des Bacteriochlorophyll a aus Rhodospirillum rubrum

Summary The esterifying alcohol of the bacteriochlorophyll a from Rhodospirillum rubrum was shown to be trans-trans-geranylgeraniol. Mass spectra of the corresponding bacteriopheophytins are used to determine the content and ratio of bacteriochlorophyll a_P and bacteriochlorophyll a_Gg in various strains of phototrophic bacteria.     

Differences in the control of bacteriochlorophyll formation by light and oxygen

Control of bacteriochlorophyll formation was studied with continuous cultures of Rhodospirillum rubrum, Rhodopseudomonas sphaeroides, and Rhodopseudomonas capsulata. Oxygen controlled specific bacteriochlorophyll contents of the three species in a hyperbolical fashion irrespective of the presence of light. In Rps. sphaeroides, this applied to oxygen concentrations above 16% air saturation of the medium while at lower oxygen concentrations control followed a kinetics with negative cooperativity. Cell protein formation of R. rubrum and Rsp. sphaeroides was independent of oxygen concentrations while protein formation of Rps. capsulata increased at lower concentrations. Light controlled bacteriochlorphyll contents of R. rubrum and Rps. sphaeroides in a sigmoidal fashion. When growing at a constant low oxygen concentration cell protein formation increased with light energy flux in Rps. sphaeroides but remained unaffected in R. rubrum. Protein formation of R. rubrum increased with light energy flux only under anaerobic conditions. Two factor analyses were performed with R. rubrum and Rps. sphaeroides to study the combined effects of light and oxygen on bacteriochlorophyll formation. The results showed that both factors act independent of each other.Abbreviations ALA 5-aminolevulinic acid - R Rhodospirillum - Rsp. Rhodopseudomonas     

Die Ausscheidung von partikelgebundenen Bacteriochlorophyllvorstufen durch die Mutante F9 von Rhodospirillum rubrum

Zusammenfassung Eine bacteriochlorophyllfreie Mutante von Rhodospirillum rubrum wird beschrieben. Diese Mutante scheidet die Bacteriochlorophyllvorstufen Phaeophorbid a und 2-Devinyl-2--Hydroxyäthyl-Phaeophorbid a unter semiaeroben Bedingungen in das Kulturmedium aus. Beide Pigmente sind mit einem Trägermolekül zu einem Komplex verbunden. Die Analyse des Komplexes ergab folgende Zusammensetzung: 49% Protein, 30% Pigment, 11% Lipide, 3% Zucker, sowie eine geringe Menge Phosphor (0,2%). Die Aminosäurezusammensetzung des Proteinanteils wird angegeben. Die Fettsäuren werden gaschromatographisch bestimmt. Die Zuckerkomponente ist anders zusammengesetzt als das Lipopolysaccharid aus Rhodospirillum rubrum. Das Molekulargewicht der kleinsten Proteinuntereinheit beträgt 16500, das Molekulargewicht des Pigmentkomplexes ergibt sich daraus mit 34000. Typische Thylakoide werden in der Mutante nicht ausgebildet. Die Notwendigkeit einer ungestört ablaufenden Bacteriochlorophyllsynthese für die normale Thylakoidmorphogenese wird diskutiert.

---

The production of particle bound bacteriochlorophyll precursors by the mutant F9 of Rhodospirillum rubrum

Summary A mutant strain of Rhodospirillum rubrum is described which does not form bacteriochlorophyll. This mutant strain excretes the bacteriochlorophyll precursors pheophorbide a and 2-devinyl-2-hydroxyethylpheophorbide a into the cultural medium, when it is cultured under low aeration in the dark. The pigments were identified spectroscopically. Both of the pigments are bound to a macromolecular compound. The complete macromolecule was shown to be composed of 49% protein, 30% pigments, 11% lipid, 3% sugar, and a trace of phosphorus (0.2%). The amino acid composition of the protein as well as the fatty acid pattern of the lipid are presented. The percent portions of fatty acids in whole cells are quite different from that of the pigment complex. The composition of the sugar moiety was demonstrated to be different from that of the lipopolysaccharide of Rhodospirillum rubrum. The molecular weight of the smallest subunit of the protein is 16,500. This suggests a molecular weight of 34,000 for the total pigment complex. Typical thylakoids were not observed in cells of the mutant strain. The necessity of an unblocked bacteriochlorophyll synthesis for the normal thylakoid morphogenesis is discussed.

     

The lipopolysaccharides of Rhodospirillum rubrum,Rhodospirillum molischianum,and Rhodopila globiformis

The cell wall lipopolysaccharides from three phototrophic species of the alpha₁-group of Proteobacteria, Rhodospirillum rubrum, Rhodospirillum molischianum, and Rhodopila globiformis were isolated and chemically characterized. Sodium deoxycholate polyacrylamide gel electrophoresis patterns revealed that the lipopolysaccharides of all three species possess O-chains. They are composed of repeating units only in R. molischianum and R. globiformis. The presence of l-glycero-d-mannoheptose and 2-keto-3-deoxyoctonate indicated core structures in all three lipopolysaccharides. Glucosamine was found as backbone amino sugar in lipid A of R. molischianum and R. rubrum, while R. globiformis has 2,3-diaminoglucose as backbone amino sugar. The latter species also differed from the two former ones in its content of hydroxy fatty acids (3-OH-14:0, 3-OH-16:0 in R. rubrum and R. molischianum and 3-OH-14:0, 3-OH-18:0 and 3-OH-19:0 (possibly iso- or anteisobranched) in R. globiformis).Abbreviations DOC-PAGE sodium deoxycholate polyacrylamide gel electrophoresis - GC/MS combined gas-liquid chromatography/mass spectrometry - KDO 2-keto-3-deoxyoctonate     

Purification and structural properties ofRhodospirillum rubrum ADPglucose pyrophosphorylase

ADPglucose pyrophosphorylase fromRhodospirillum rubrum has been purified to homogeneity or near homogeneity using affinity chromatography techniques. The subunit molecular weight of the enzyme is 50,000. Thus, the enzyme is similar in subunit molecular weight to that found for other bacterial ADPglucose pyrophosphorylases. The amino acid composition is similar to that found for theRhodospirillum tenue enzyme. However, the N-terminal amino acid sequence of theR. rubrum enzyme shows no apparent homology with theR. tenue enzyme N-terminal amino acid sequence.     

Reversible ADP-ribosylation as a mechanism of enzyme regulation in procaryotes

Several cases of ADP-ribosylation of endogenous proteins in procaryotes have been discovered and investigated. The most thoroughly studied example is the reversible ADP-ribosylation of the dinitrogenase reductase from the photosynthetic bacteriumRhodospirillum rubrum and related bacteria. A dinitrogenase reductase ADP-ribosyltransferase (DRAT) and a dinitrogenase reductase ADP-ribose glycohydrolase (DRAG) fromR. rubrum have been isolated and characterized. The genes for these proteins have been isolated and sequences and show little similarity to the ADP-ribosylating toxins. Other targets for endogenous ADP-ribosylation by procaryotes include glutamine synthetase inR. rubrum andRhizobium meliloti and undefined proteins inStreptomyces griseus andPseudomonas maltophila.     

Characterization of the interaction of dinitrogenase reductase-activating glycohydrolase from Rhodospirillum rubrum with bacterial membranes

The interaction of dinitrogenase reductase-activating glycohydrolase (DRAG) with bacterial membranes and the solubilization of DRAG in response to nucleotides were characterized. Purified DRAG from Rhodospirillum rubrum reversibly bound bacterial pellet fractions from Rsp. rubrum and other nitrogen-fixing bacteria. DRAG saturated the membrane fraction of Rsp. rubrum at a concentration of 0.2 mol DRAG/mol bacteriochlorophyll, suggesting that the DRAG-binding species is prevalent in the membrane. DRAG bound poorly to phospholipid vesicles, suggesting a protein requirement for DRAG interaction with the membrane. Guanosine and uridine tri- and di-nucleotides specifically dissociated DRAG from the pellet fractions of Rsp. rubrum and Azotobacter vinelandii, while adenosine nucleotides had no dissociative effect. Guanosine 5′-triphosphate dissociated DRAG from the membrane at a concentration causing 50% dissociation (EC₅₀) of 5.0 ± 0.5 mM; guanosine disphosphate had an EC₅₀ of 15.0 ± 2.0 mM. We propose that GTP is a potential participant in the regulation of DRAG, possibly controlling the extent of DRAG association with the membrane. Received: 2 November 1998 / Accepted: 6 April 1999     

Characterization of the pet operon of Rhodospirillum rubrum

The three genes of the pet operon, coding, respectively, for the Rieske iron-sulfur protein, cytochrome b and cytochrome c ₁ components of the cytochrome bc ₁ complex in the photosynthetic bacterium Rhodospirillum rubrum have been sequenced. The amino acid sequences deduced for these three peptides from the nucleotide sequences of the genes have been confirmed, in part, by direct sequencing of portions of the three peptides separated from a sample of the purified, detergent-solubilized complex. These sequences show considerable homology with those previously obtained for the pet operons of other photosynthetic bacteria. Northern blots of R. rubrum mRNA have established that the operon is transcribed as a single polycistronic message, the start site of which has been determined by both primer extension and nuclease protection. Photosynthetic growth of R. rubrum was shown to be inhibited by antimycin A, a specific inhibitor of cytochrome bc ₁ complexes, and antimycin A-resistant mutants of R. rubrum have been isolated. Preliminary results suggest that it may be possible to express the R. rubrum pet operon in a strain of the photosynthetic bacterium Rhodobacter capsulatus from which the native pet operon has been deleted.     

Mechanisms of CO2 fixation in bacterial photosynthesis studied by the carbon isotope fractionation technique

1. The carbon isotope discrimination properties of a representative of each of the three types of photosynthetic bacteria Chlorobium thiosulfatophilum, Rhodospirillum rubrum and Chromatium and of the C₃-alga Chlamydomonas reinhardii were determined by measuring the ratio of ¹³CO₂ to ¹²CO₂ incorporated during photoautotrophic growth. 2. Chromatium and R. rubrum had isotope selection properties similar to those of C₃-plants, whereas Chlorobium was significantly different. 3. The results suggest that Chromatium and R. rubrum assimilate CO₂ mainly via ribulose 1,5-diphosphate carboxylase and the associated reactions of the reductive pentose phosphate cycle, whereas Chlorobium utilizes other mechanisms. Such mechanisms would include the ferredoxin-linked carboxylation enzymes and associated reactions of the reductive carboxylic acid cycle.Abbreviations RuDP ribulose 1,5-disphosphate - PEP phosphoenolpyruvate     

Amino acid sequence of ferredoxin II from the phototroph Rhodospirillum rubrum: Characteristics of a 7Fe ferredoxin

The complete sequence of amino acids of ferredoxin II (FdII) from Rhodospirillum rubrum was determined by repetitive Edman degradation using pyridylethylated-ferredoxin and oxidized, denatured ferredoxin. Peptides derived from trypsin, pepsin, Glu-C endoproteinase, Arg-C endoproteinase, tryptophan specific cleavage and partial acid hydrolysis and C-terminal sequence from carboxypeptidase digestion were used to construct the total sequence. RrFdII is a polypeptide of 104 amino acids having a calculated molecular weight of 11556 excluding the iron and sulfur atoms. The complete amino acid sequence was: PYVVTENCIKCKYQDCVEVCPVDCFYEGENFLVINPDECIDCGVCNPECPAEAIAGKWLEINRKFADLWPNITRKGPAL ADADDWKDKPDKTGLLSENPGKGTV. Sequence comparisons, EPR characteristics and iron analyses indicate that RrFdII has structural features in common with ferredoxins containing [3Fe-4S], [4Fe-4S] centers. Of 104 amino acids, 60 (58%) including all 9 cysteines, are found in identical locations in the 7Fe ferredoxin prototype, Azotobacter vinelandii FdI.The protein sequence data reported in this paper will appear in the SWISS-PROT database and EMBL Data Library under the accession number P80448.     

Competition between light and dark metabolism in Rhodospirillum rubrum

Summary In the presence of both light and air, the metabolism of Rhodospirillum rubrum can be partly respiratory and partly photosynthetic. The relative rates of these modes of metabolism have been measured at a variety of light intensities and oxygen tensions.     

Ein neues Bacteriochlorophyll aus Rhodospirillum rubrum

Zusammenfassung Rhodospirillum rubrum und Rhodopseudomonas palustris enthalten ein Bacteriochlorophyll, das mit Farnesol statt mit Phytol veretert ist. Das neue Bacteriochlorophyll (Bchl a_F) läßt sich vom bekannten Bacteriochlorophyll a (Bchl a_P) durch ¹H-NMR-Spektroskopie unterscheiden sowie durch Dünnschichtchromatographie der entsprechenden Phäophytine an mit Silbernitrat imprägniertem Kieselgel. Die Chromophore von Bchl a_F und Bchl a_P sind auch bezüglich ihrer Stereochemie identisch.

---

A new bacteriochlorophyll from Rhodospirillum rubrum

Summary Rhodospirillum rubrum and Rhodopseudomonas palustris contain a bacteriochlorophyll which is a farnesyl rather than a phytyl ester. The new bacteriochlorophyll (Bchl a_F) can be distinguished from the well known bacteriochlorophyll a (Bchl a_P) by ¹H-n.m.r. spectroscopy and by t.l.c. of the corresponding pheophytins on silver nitrate impregnated silica gel. The chromophores of Bchl a_P and Bchl a_F are identical in structure and stereochemistry.

     

Biochemistry and physiology of nitrogen fixation with particular emphasis on nitrogen-fixing phototrophs

Summary This paper presents an overview of aspects of N₂-fixation in phototrophic N₂-fixers. Nitrogenase is little different in phototrophs from other organisms. Evidence suggests that fixed carbon dissimilation rather than direct photoreduction from oxidised inorganic compounds or exogenous photosynthetic electron donors is the major route of reductant supply to nitrogenase in phototrophs; inRhodospirillum rubrum pyruvate is a possible electron donor to nitrogenase; in cyanobacteria the oxidative pentose phosphate pathway is important, although some recent evidence implicates glycolysis and the tricarboxylic acid cycle in reductant supply in heterocystous cyanobacteria. In photosynthetic organisms light modulation of various enzymes occurs-some Calvin cycle enzymes are light activated, some oxidative pentose phosphate pathway and glycolytic enzymes are deactivated and some tricarboxylic acid cycle enzymes are activated. Reduced levels of thioredoxin in heterocysts may contribute to the sustained functioning of the oxidative pentose phosphate pathway in heterocysts in the light and dark. In photosynthetic bacteria such asRhodospirillum rubrum an activating enzyme which removes a modifying group from inactive Fe protein can activate nitrogenase. O₂ and NH ₄ ⁺ both inhibit N₂-fixation and there is some evidence in cyanobacteria that O₂ stability of whole cell nitrogenase can be achieved by prolonged incubation of cultures at high O₂.     

Purification and properties of the carbonic anhydrase of Rhodospirillum rubrum

The carbonic anhydrase (EC 4.2.1.1) of Rhodospirillum rubrum has been purified to apparent homogeneity and some of its properties have been determined. The enzyme was cytoplasmic and was found only in photosynthetically grown cells. It had a molecular weight of about 28,000, and was apparently composed of two equal subunits. The amino acid composition was similar to that of other reported carbonic anhydrases except that the R. rubrum enzyme contained no arginine. The isoelectric point of the enzyme was 6.2 and the pH optimum was 7.5. It required Zn(II) for stability and enzymatic activity. The K _m(CO₂) was 80 mM. Typical carbonic anhydrase inhibition patterns were found with the R. rubrum enzyme. Strong acetazolamide and sulfanilamide inhibition confirmed the importance of Zn(II) for enzymatic activity as did the anionic inhibitors iodide, and azide. Other inhibitors indicated that histidine, sulfhydryl, lysine and serine residues were important for enzymatic activity.Abbreviation CA carbonic anhydrase In memory of R. Y. Stanier     

Genes encoding ribulosebisphosphate carboxylase and phosphoribulokinase are duplicated in Pseudomonas carboxydovorans and conserved in carboxydotrophic bacteria

Heterologous gene probes derived from cfxLp and cfxPp genes of Alcaligenes eutrophus H16 revealed the presence of structural genes encoding ribulosebisphosphate carboxylase (Rubisco) and phosphoribulokinase (PRK) on the genome of carboxydotrophic bacteria. The two genes were found to be rather conserved. In Pseudomonas carboxydovorans OM5 cfx genes reside on the plasmid pHCG3 and the chromosome as well, indicating that they are duplicated. Also in all plasmidharboring carboxydotrophic bacteria cfxL and cfxP structural genes were found to be plasmid-coded. Our results extend the list of carboxydotrophy structural genes residing on the plasmid pHCG3 and strongly support the idea that the components essential for the chemolithoautotrophic utilization of CO by Pseudomonas carboxydovorans OM5 are plasmid-coded. A cfxL gene probe from Rhodospirillum rubrum did not detectably hybridize with DNA from any of the carboxydotrophic bacteria examined.Abbreviations CODH carbon monoxide dehydrogenase - H₂ase hydrogenase - kb kilobase - PRK phosphoribulokinase - Rubisco ribulosebisphosphate carboxylase - SDS sodium dodecylsulfate