Age and Growth of the Black Scorpionfish Scorpaena porcus Linnaeus, 1758 (Scorpaeniformes: Scorpaenidae) under Anthropogenic Pressure in the Black Sea

Journal of Ichthyology - Age structure and growth dynamics are examined for the black scorpionfish Scorpaena porcus Linnaeus, 1758, from three sites characterized by different levels of pollution:...     

Age and growth of stargazer (Uranoscopus scaber L., 1758) in the southeastern Black Sea

A sample of 346 Uranoscopus scaber (L., 1758) was collected from the southeastern Black Sea between January 2002 and May 2005 in order to provide information on age, growth, length–weight relationship, and stomach contents of this species. Total length and total weight of sampled fish ranged from 5.2 to 21.9 cm and from 2.0 to 182.5 g, respectively. The sex ratio (1 : 1.98) was biased toward females (P < 0.05). Isometric growth was determined in the population. Length–weight relationships for all individuals were described by the parameters: a = 0.0167, b = 3.00, with the r² = 0.99. The population was composed of five age‐classes (I–V years). The von Bertalanffy growth parameters (±SE) and confidence limit (CL, 95%) for the entire population were: L_∞ = 26.31 ± 0.838 cm (CL: 24.66–27.96), k = 0.339 ± 0.023 1/year (CL: 0.294–0.385), and t_o = 0.087 ± 0.0346 year (CL: 0.019–0.155) (r² = 0.96). Growth performance index (Φ) was 2.37. The diet was composed of Gobius sp. (2.2%),Trachurus trachurus (2.1%), Merlangius merlangus euxinus (4.3%) and unidentified fish species (17.4%); 39.1% were unidentified remains.     

Body Size,Age Structure,Growth, and Maturation of Black Scorpionfish Scorpaena porcus (Scorpaenidae) from Southwestern Crimea (Black Sea)

Journal of Ichthyology - The body size and age structure, as well as the features of growth and sexual maturation, of black scorpionfish Scorpaena porcus from the coastal waters of southwestern...     

Age, growth and reproduction of the black scorpionfish, Scorpaena porcus (Pisces, Scorpaenidae), on the Black Sea coast of Turkey

Age, growth and reproduction of the black scorpionfish, Scorpaena porcus were studied in specimens from the coast of the Sinop Peninsula (Black Sea) between March 2002 and April 2003 in order to characterize these population parameters in comparison to specimens from populations of nearby regions. A total of 1086 specimens was captured by beam trawl at the depths between 0 and 30 m. The total number of females (510) was significantly higher than that of males (373). Total length of males and females ranged between 5.7 and 23.6 cm, and 4.9 and 31.7 cm, respectively. The length–weight relationship showed a positive allometric growth. Females grew faster and reached a larger size at age than males ( L _∞ = 111.9 cm, K  = 0.035 year⁻¹, φ' = 2.64 for females, and L _∞ = 74.6 cm, K  = 0.054 year⁻¹, φ' = 2.49 for males). The age range estimated was up to 8 years for females and 5 years for males. Reproduction likely occurs between June and September. Sex ratio varied greatly with season, perhaps indicating different seasonal migratory patterns in adults of different sex. An inverse correlation between gonadosomatic index (GSI) and hepatosomatic index (HSI) was evident during the reproduction seasons. The mean size at first sexual maturity was 17.5 cm TL for females, and 16.7 cm TL for males.     

Catalase and Superoxide Dismutase Activity in Erythrocytes and the Methemoglobin Level in Blood of the Black Scorpionfish (Scorpaena porcus,Linnaeus 1758) Exposed to Acute Hypoxia

Russian Journal of Marine Biology - The effect of exposure to acute hypoxia on the level of methemoglobin (MtHb) in blood and the activity of catalase (CAT) and superoxide dismutase (SOD) in...     

Primary Structure of Insulin of the Black Sea Rockfish Scorpaena porcus

Insulin of the Black Sea rockfish Scorpaena porcus was isolated, purified, and the primary sequence has been determined. The hormone amino acid sequence has been established: the A chain—GIVEQCCNRPCNIFDLQNYCN, and the B chain—AAGPQHLCGSHLVDALYLVCGDRGFFYNPK. The rockfish insulin, in comparison with the human one, has 14 amino acid substitutions; an additional alanine is present at the N-terminal of the B-chain, whereas the 30th amino acid at the C-terminal is absent. In in vitro experiment, the 50% inhibition of the pork ¹²⁵I-insulin binding to the rat liver plasma membrane was 4 nM, i.e., 50% of the standard pork insulin affinity (2 nM) to the insulin receptors. The pork rockfish insulin biological activity as determined in the mouse convulsion test in vivo was 18 ± 2.2 ME/mg or 75% of the pork hormone activity. It is suggested that the relatively low rockfish insulin biological activity is due to the presence of A8 asparagine position in the hormone structure     

Methemoglobin and the Activities of Catalase and Superoxide Dismutase in Nucleated Erythrocytes of Scorpaena porcus (Linnaeus, 1758) under Experimental Hypoxia (in vitro)

The effect of hypoxia on nucleated red blood cells of the black scorpionfish (Scorpaena porcus) was studied in vitro. Deep hypoxia (the oxygen concentration was less than 1 mg O₂ L^–1; the norm was 7–8 mg O₂ L^–1) led to the transition of a part of the hemoglobin molecules to the ferric state (methemoglobin). The maximum increase in the concentration of methemoglobin was 32%. The accumulation of methemoglobin in red blood cells was accompanied by an increase in the activity of catalase and superoxide dismutase and a decrease in the content of reactive oxygen species in the cytoplasm of cells. It was shown that the formation of methemoglobin did not cause damage to the cytoplasmic membranes of red blood cells. The percentage of red blood cell lysis in deoxygenated (less than 1.0 mg O₂ L^–1) suspensions quantitatively coincided with the control values.

     

Age and growth of Boops boops (Linnaeus, 1758) in Izmir Bay,Aegean Sea,Turkey

The present study was conducted to determine the age relationships in lengths and weights of Boops boops (Linneaus, 1756) in Izmir Bay, central Aegean Sea. A total of 932 specimens (503 females and 429 males) were caught by gillnet, trammel net and a combination thereof on a monthly sampling basis from November 2008 through October 2009. Total length and weight of sampled fish ranged from 11.3 to 27.9 cm and from 12.2 to 261.7 g, with a mean of 19.6 cm and 82.7 g, respectively. Length‐weight relationships for all individuals were described by the parameters a = 0.0050, b = 3.237 and r² = 0.956. The von Bertalanffy growth curve fitted to the lengths‐at‐age provided parameters of L_∞ = 29.87 cm k = 0.243 and t_o = ?0.98 for males and L_∞ = 30.79 cm, k = 0.239 and t_o = ?0.90 for females. Based on otolith readings, age determinations varied from 1 to 5 years. Maximum age was 5 years in age group 2, with 29.84 and 37.97% for males and females, respectively. The overall 1 : 1.17 sex ratio of males to females was significantly biased toward females (P < 0.05). There was no statistical difference in the mean condition factor (P > 0.05), with a value of 1.028 for the entire population. The growth performance index (Φ^’) was 2.33 and 2.36 for males and females, respectively. Results were similar to other geographical areas, which suggests that a common fisheries management might be possible.     

Tissue Peculiarities of Energy Metabolism Enzyme Activity and ATP Content In Black Sea Ruff Scorpaena porcus (Scorpaenidae)

Journal of Ichthyology - The activities of cytosolic oxidoreductases (malate and lactate dehydrogenases) and the level of ATP production in the hypoxic resistive tissues of Scorpaena porcus...     

Age and growth of pearly razorfish,Xyrichtys novacula (Linnaeus 1758), in the central Mediterranean Sea

Age and growth of pearly razorfish Xyrichtys novacula (Labridae) were determined in specimens caught on sandy bottoms by surrounding nets and lines (depth range 5–30 m) between January 2000 and December 2002. The study location was in the central Mediterranean Sea. For this purpose the annual growth increments (annuli) in sagittae were analysed. A total of 470 individuals of X. novacula, ranging from 49 to 200 mm TL (total length), were examined. Conversion between total length and standard length was calculated and represented by the relationship: . Edge analysis on otoliths was carried out to validate seasonality deposition. Seven age‐classes were determined from 0+ to 6+. The linear relationship between maximum otolith length (OL) and TL was summarized in the equation . The estimated parameters of the von Bertalanffy growth function were L = 175.05 mm, k = 0.80 year^?1, t₀ =?0.73 years and the growth performance index calculated as (Φ = 2.39). The length–weight relationship W = 0.0139 TL^2.9326 described an isometric growth for the species in this area.     

Maximum length and age report of Sparus aurata (Linnaeus, 1758) in the Black Sea

The presence of gilthead sea bream (Sparus aurata) in the Black Sea, albeit sparse, has been known for many years. In recent years, it has been encountered in fishing nets, most commonly as by‐catch. In this study conducted in the southern Black Sea (Ordu) region, three female individuals were caught in trammel nets on October 9, 2017, and the largest individual was found to have a total length of 61.4 cm, a weight of 3080.6 g, and a gonad weight of 115.59 g. The metric and meristic characteristics of the largest individual sampled were also determined.     

Age, growth, sexual maturity and food composition of Sciaena umbra in the south-eastern Black Sea, Turkey

Studied were the age, growth, maturity and food composition of the brown meager, Sciaena umbra, caught off Trabzon, south-eastern Black Sea (Turkey) in 2002–2003. A total of 329 individuals was collected by spear fishing and hand nets. The thin sectioning method was used for aging the fish otoliths. Fitted von Bertalanffy growth parameters for all fish were: L _∞ = 51.14 (±1.19) cm, k  =   0.27 (±0.02) year⁻¹ and t ₀ = −0.93 (±0.07) year. This study revealed that S. umbra is a relatively slow-growing and long-lived species with a life span in excess of 18 years. Sexual maturity begins when they reach a length of about 15 cm. Lengths at which 50% of brown meagre become mature are 19.50 for males and about 22 cm for females. Spawning begins in June, when the temperature is approximately 18°C, and ends in August. Gut content analysis indicated that this species feeds mainly on crustaceans, then switches to fish as they grow. Sciaena umbra appears to be an apex predator in the upper littoral zone.     

Population parameters of stargazer (Uranoscopus scaber Linnaeus, 1758) in the southeastern Black Sea region during the 2011–2012 fishing season

The population parameters of stargazer (Uranoscopus scaber Linnaeus, 1758) were studied regarding age composition, sex ratio, growth, survival and mortality rates, and the exploitation rate in the southeastern Black Sea near the coast of Turkey during the 2011–2012 fishing season. According to ageing analysis of the samples, age group 1 is the most abundant (47.76%), followed by age 2 (41.04%), age 3 (9.33%), age 0 (1.12%) and age 4 (0.75%). Mean totals as well as total lengths and weights for males and females were 14.5 ± 0.22 cm and 12.9 ± 0.19 g, 16.6 ± 0.24 cm and 62.1 ± 2.76 g, and 37.2 ± 1.92 cm and 87.1 ± 3.88 g, respectively. The mean condition factor was K = 0.0167, while the sex ratio was 53.98% female, 38.75% male and 7.27% immature. Length‐weight, age‐length and age‐weight equations were W = 0.014 × L^3.059, L_(t)=44.5*[1?e^{?0.148*(t +1.242)}] and W_(t)=1544.4*[1?e^{?0.148*(t + 1.242)}]^3.059, respectively. The computed survival rate (S), instantaneous total mortality rate (Z), annual mortality rate (A), natural mortality rate (M) and fishing mortality rate (F) were S = 28.94%, Z = 1.24 year^?1, A = 71.06%, M = 0.26 year^?1 and F = 0.98 year^?1, respectively. The exploitation rate was 0.79, which is above the optimum exploitation levels.     

Age,growth and mortality of the comber Serranus cabrilla (Linnaeus, 1758) in the Eastern Atlantic

Comber is an important bycatch species in the trawl fishery both in the Mediterranean and the Atlantic. Age and growth studies have been restricted to the eastern Mediterranean and no methodologies were ever applied to ensure accuracy and precision. In this study a total of 471 otoliths from specimens ranging from 12 to 26?cm were used. Precision indices showed a high level of agreement between readers and no evidence of systematic disagreement was obtained. To estimate fish growth and due to the absence of individuals smaller than 12?cm, three approaches were used to estimate the von Bertalanffy growth parameters: whole otolith readings, back calculation and a combination of both methodologies. Akaike’s information criterion suggests that the back calculation approach was the best one for describing comber growth: TL?=?25.26 [1?e^{(?0.21(t+1.72)}]. Natural mortality estimates varied between M?=?0.44 year^?1 and M?=?0.48 year^?1 while estimates of the fishing mortality varied between 0.12 year^?1 and 0.16 year^?1 and the exploitation rate between 0.20 and 0.27.     

Age,growth, reproduction and feed of longnosed skate,Dipturus oxyrinchus (Linnaeus, 1758) in Saros Bay,the north Aegean Sea

The age, growth, reproduction, and feeding of longnosed skate (Dipturus oxyrinchus) were studied using 179 specimens from the Saros Bay (North Aegean Sea) between March 2005 and December 2007. Composition was 49.7% females and 50.3% males. Total length of females ranged from 14.9 to 100 cm (disc width, 9.8–65 cm), and of males from 15.2 to 86.5 cm (disc width, 10–57.5 cm). Total length‐weight and disc width‐weight relationships are described by the equations W = 0.0008*TL^3.35 and W = 0.0043*DW^3.29, respectively. The age data, derived from vertebrae readings, were used to estimate the growth parameters of the von Bertalanffy equation: L_∞ = 256.46 cm, K = 0.04 year^?1, t₀ = ?1.17year. The maximum age was 9 years. Males matured at 64–65 cm (disc width, 43.5 cm) and females at 82–83 cm TL (disc width, 53 cm). The stomach contained mainly Parapenaus longirostris, IRI: 93.47%.     

Age and growth of Trisopterus luscus (Linnaeus, 1758) (Pisces,Gadidae) off the coast of Asturias

The age and growth of an Asturian population of the bib Trisopterus luscus L. were studied based on 990 bibs from monthly catches from October 1986 until October 1988.Using the estimates of age taken from otolith readings, it was possible to construct a growth curve for the whole range of ages and demonstrate that most growth takes place during the first two years of life. The maximum age was found to be 5 years. The largest fish caught during the investigation measured 430 mm in standard length.The different growth rates of males and females show that in most cases the mean standard length of females was equal to or greater than that of the males.     

Diet composition of young-of-the-year saddled bream, Oblada melanura (Linnaeus, 1758) from the eastern central Adriatic Sea

Stomach contents of 144 specimens of Oblada melanura were analyzed for diet composition. All specimens belonged to the 1‐year age group. Material was collected from the localities of Kornati Archipelago and Murter Island in the eastern central Adriatic during 1992–1993. Copepod crustaceans were the main food, while Cladocera crustaceans were the second most important. Feeding intensity was very high as indicated by high stomach fullness index and low vacuity index.