共查询到20条相似文献,搜索用时 15 毫秒
1.
2.
Ros Barceló A 《Planta》2005,220(5):747-756
Lignification in Zinnia elegans L. stems is characterized by a burst in the production of H2O2, the apparent fate of which is to be used by xylem peroxidases for the polymerization of p-hydroxycinnamyl alcohols into lignins. A search for the sites of H2O2 production in the differentiating xylem of Z. elegans stems by the simultaneous use of optical (bright field, polarized light and epi-polarization) and electron-microscope tools revealed that H2O2 is produced on the outer-face of the plasma membrane of both differentiating (living) thin-walled xylem cells and particular (non-lignifying) xylem parenchyma cells. From the production sites it diffuses to the differentiating (secondary cell wall-forming) and differentiated lignifying xylem vessels. H2O2 diffusion occurs mainly through the continuous cell wall space. Both the experimental data and the theoretical calculations suggest that H2O2 diffusion from the sites of production might not limit the rate of xylem cell wall lignification. It can be concluded that H2O2 is produced at the plasma membrane in differentiating (living) thin-walled xylem cells and xylem parenchyma cells associated to xylem vessels, and that it diffuses to adjacent secondary lignifying xylem vessels. The results strongly indicate that non-lignifying xylem parenchyma cells are the source of the H2O2 necessary for the polymerization of cinnamyl alcohols in the secondary cell wall of lignifying xylem vessels. 相似文献
3.
Adenosine 5-triphosphate receptors are known to be involved in fast excitatory postsynaptic currents in myenteric neurons of the digestive tract. In the present study, the distribution of P2X2 and P2X3 receptor mRNA was examined by in situ hybridisation while P2X2 and P2X3 receptor protein was localised by immunohistochemical methods. In addition, P2X2 and P2X3 receptors were colocalised with calbindin and calretinin in the myenteric and submucosal plexus. P2X2- and P2X3-immunoreactive neurons were found in the myenteric and submucosal plexuses throughout the entire length of the rat digestive tract from the stomach to the colon. Approximately 60%, 70% and 50% of the ganglion cells in the myenteric plexus of the gastric corpus, ileum and distal colon, and 56% and 45% in the submucosal plexus of the ileum and distal colon, respectively, showed positive immunoreactivity to the P2X2 receptor. Approximately 10%, 2% and 15% of the ganglion cells in the myenteric plexus of the gastric corpus, ileum and distal colon, and 62% and 40% in the submucosal plexus of the ileum and distal colon, respectively, showed positive immunoreactivity to the P2X3 receptor. Double-labelling studies showed that about 10–25% of the neurons with P2X2 immunoreactivity in myenteric plexus and 30–50% in the submucosal plexus were found to express calbindin or calretinin. About 80% of the neurons with P2X3 receptor immunoreactivity in the myenteric plexus and about 40% in the submucosal plexus expressed calretinin. Approximately 30–75% of the neurons with P2X3 receptor immunoreactivity in the submucosal plexus expressed calbindin, while none of them were found to express calbindin in the myenteric plexus. 相似文献
4.
The histochemical and cytochemical localization of abscisic acid (ABA)-induced H2O2 production in leaves of maize (Zea mays L.) plants were examined, using 3,3-diaminobenzidine (DAB) and CeCl3 staining, respectively, and the relationship between ABA-induced H2O2 production and ABA-induced subcellular activities of antioxidant enzymes was studied. H2O2 generated in response to ABA treatment was detected within 0.5 h in major veins of the leaves and maximized at about 2–4 h. In mesophyll and bundle sheath cells, ABA-induced H2O2 accumulation was observed only in apoplast, and the greatest accumulation occurred in the walls of mesophyll cells facing large intercellular spaces. Meanwhile, ABA treatment led to a significant increase in the activities of the leaf chloroplastic and cytosolic antioxidant enzymes superoxide dismutase (SOD), ascorbate peroxidase (APX) and glutathione reductase (GR), and pretreatment with the NADPH oxidase inhibitor diphenyleneiodonium (DPI), the O
2
−
scavenger Tiron and the H2O2 scavenger dimethylthiourea (DMTU) almost completely arrested the increase in the activities of these antioxidant enzymes. Our results indicate that the accumulation of apoplastic H2O2 is involved in the induction of the chloroplastic and cytosolic antioxidant enzymes. Moreover, an oxidative stress induced by paraquat (PQ), which generates O
2
−
and then H2O2 in chloroplasts, also up-regulated the activities of the chloroplastic and cytosolic antioxidant enzymes, and the up-regulation was blocked by the pretreatment with Tiron and DMTU. These data suggest that H2O2 produced at a specific cellular site could coordinate the activities of antioxidant enzymes in different subcellular compartments. 相似文献
5.
6.
Several studies have shown improved soil stability under elevated atmospheric CO2 caused by increased plant and microbial biomass. These studies have not quantified the mechanisms responsible for soil stabilisation
or the effect on water relations. The objective of this study was to assess changes in water repellency under elevated CO2. We hypothesised that increased plant biomass will drive an increase in water repellency, either directly or through secondary
microbial processes. Barley plants were grown at ambient (360 ppm) and elevated (720 ppm) CO2 concentrations in controlled chambers. Each plant was grown in a separate tube of 1.2 m length constructed from 22 mm depth
× 47 mm width plastic conduit trunk and packed with sieved arable soil to 55% porosity. After 10 weeks growth the soil was
dried at 40°C before measuring water sorptivity, ethanol sorptivity and repellency at many depths with a 0.14 mm radius microinfiltrometer.
This provided a microscale measure of the capacity of soil to rewet after severe drying. At testing roots extended throughout
the depth of the soil in the tube. The depth of the measurement had no effect on sorptivity or repellency. A rise in CO2 resulted in a decrease in water sorptivity from 1.13 ± 0.06 (s.e) mm s−1/2 to 1.00 ± 0.05 mm s−1/2 (P < 0.05) and an increase in water repellency from 1.80 ± 0.09 to 2.07 ± 0.08 (P < 0.05). Ethanol sorptivity was not affected by CO2 concentration, suggesting a similar pore structure. Repellency was therefore the primary cause of decreased water sorptivity.
The implications will be both positive and negative, with repellency potentially increasing soil stability but also causing
patchier wetting of the root-zone. 相似文献
7.
Although arsenic is an infamous carcinogen, it has been effectively used to treat acute promyelocytic leukemia, and can induce
cell cycle arrest or apoptosis in human solid tumors. Previously, we had demonstrated that opposing effects of ERK1/2 and
JNK on p21 expression in response to arsenic trioxide (As2O3) are mediated through the Sp1 responsive elements of the p21 promoter in A431 cells. Presently, we demonstrate that Sp1,
and c-Jun functionally cooperate to activate p21 promoter expression through Sp1 binding sites (−84/−64) by using DNA affinity
binding, chromatin immunoprecipitation, and promoter assays. Surprisingly, As2O3-induced c-Jun(Ser63/73) phosphorylation can recruit TGIF/HDAC1 to the Sp1 binding sites and then suppress p21 promoter activation.
We suggest that, after As2O3 treatment, the N-terminal domain of c-Jun phosphorylation by JNK recruits TGIF/HDAC1 to the Sp1 sites and then represses p21
expression. That is, TGIF is involved in As2O3-inhibited p21 expression, and then blocks the cell cycle arrest. 相似文献
8.
CXCL6‐EGFR‐induced Kupffer cells secrete TGF‐β1 promoting hepatic stellate cell activation via the SMAD2/BRD4/C‐MYC/EZH2 pathway in liver fibrosis 下载免费PDF全文
Xiaobo Cai Zhenghong Li Qidi Zhang Yin Qu Mingyi Xu Xinjian Wan Lungen Lu 《Journal of cellular and molecular medicine》2018,22(10):5050-5061
Liver fibrosis is the excessive accumulation of extracellular matrix proteins in response to the inflammatory response that accompanies tissue injury, which at an advanced stage can lead to cirrhosis and even liver failure. This study investigated the role of the CXC chemokine CXCL6 (GCP‐2) in liver fibrosis. The expression of CXCL6 was found to be elevated in the serum and liver tissue of high stage liver fibrosis patients. Furthermore, treatment with CXCL6 (100 ng/mL) stimulated the phosphorylation of EGFR and the expression of TGF‐β in cultured Kupffer cells (KCs). Although treatment with CXCL6 directly did not activate the hepatic stellate cell (HSC) line, HSC‐T6, HSCs cultured with media taken from KCs treated with CXCL6 or TGF‐β showed increased expression of α‐SMA, a marker of HSC activation. CXCL6 was shown to function via the SMAD2/BRD4/C‐MYC/EZH2 pathway by enhancing the SMAD3‐BRD4 interaction and promoting direct binding of BRD4 to the C‐MYC promoter and CMY‐C to the EZH2 promoter, thereby inducing profibrogenic gene expression in HSCs, leading to activation and transdifferentiation into fibrogenic myofibroblasts. These findings were confirmed in a mouse model of CCl4‐induced chronic liver injury and fibrosis in which the levels of CXCL6 and TGF‐β in serum and the expression of α‐SMA, SMAD3, BRD4, C‐MYC, and EZH2 in liver tissue were increased. Taken together, our results reveal that CXCL6 plays an important role in liver fibrosis through stimulating the release of TGF‐β by KCs and thereby activating HSCs. 相似文献
9.
There is abundant evidence that extracellular ATP and other nucleotides have an important role in pain signaling at both the periphery and in the CNS. At first, it was thought that ATP was simply involved in acute pain, since ATP is released from damaged cells and excites directly primary sensory neurons by activating their receptors. However, neither blocking P2X/Y receptors pharmacologically nor suppressing the expression of P2X/Y receptors molecularly in sensory neurons or in the spinal cord had an effect on acute physiological pain. The focus of attention now is on the possibility that endogenous ATP and its receptor system might be activated in pathological pain states, particularly in neuropathic pain. Neuropathic pain is often a consequence of nerve injury through surgery, bone compression, diabetes or infection. This type of pain can be so severe that even light touching can be intensely painful; unfortunately, this state is generally resistant to currently available treatments. An important advance in our understanding of the mechanisms involved in neuropathic pain has been made by a recent work demonstrating the crucial role of ATP receptors (i.e., P2X3 and P2X4 receptors). In this review, we summarize the role of ATP receptors, particularly the P2X4 receptor, in neuropathic pain. The expression of P2X4 receptors in the spinal cord is enhanced in spinal microglia after peripheral nerve injury, and blocking pharmacologically and suppressing molecularly P2X4 receptors produce a reduction of the neuropathic pain behaviour. Understanding the key roles of ATP receptors including P2X4 receptors may lead to new strategies for the management of neuropathic pain. 相似文献
10.
We describe the long-term effects of a CO2 exhalation, created more than 70 years ago, on a natural C4 dominated sub-tropical grassland in terms of ecosystem structure and functioning. We tested whether long-term CO2 enrichment changes the competitive balance between plants with C3 and C4 photosynthetic pathways and how CO2 enrichment has affected species composition, plant growth responses, leaf properties and soil nutrient, carbon and water dynamics. Long-term effects of elevated CO2 on plant community composition and system processes in this sub-tropical grassland indicate very subtle changes in ecosystem functioning and no changes in species composition and dominance which could be ascribed to elevated CO2 alone. Species compositional data and soil δ13C isotopic evidence suggest no detectable effect of CO2 enrichment on C3:C4 plant mixtures and individual species dominance. Contrary to many general predictions C3 grasses did not become more abundant and C3 shrubs and trees did not invade the site. No season length stimulation of plant growth was found even after 5 years of exposure to CO2 concentrations averaging 610 μmol mol−1. Leaf properties such as total N decreased in the C3 but not C4 grass under elevated CO2 while total non-structural carbohydrate accumulation was not affected. Elevated CO2 possibly lead to increased end-of-season soil water contents and this result agrees with earlier studies despite the topographic water gradient being a confounding problem at our research site. Long-term CO2 enrichment also had little effect on soil carbon storage with no detectable changes in soil organic matter found. There were indications that potential soil respiration and N mineralization rates could be higher in soils close to the CO2 source. The conservative response of this grassland suggests that many of the reported effects of elevated CO2 on similar ecosystems could be short duration experimental artefacts that disappear under long-term elevated CO2 conditions. 相似文献
11.
Ye Tao Tianming Qiu Xiaofeng Yao Liping Jiang Ningning Wang Jintong Jiang Xue Jia Sen Wei Jingyuan Zhang Yuhan Zhu Wenyue Tian Guang Yang Xiaofang Liu Shuang Liu Yang Ding Xiance Sun 《Journal of cellular physiology》2021,236(2):1469-1480
Liver fibrosis is a severe health problem worldwide, and it is characterized by the activation of hepatic stellate cells (HSCs) and excessive deposition of collagen. Prolonged arsenic exposure can induce HSCs activation and liver fibrosis. In the present study, the results showed that chronic NaAsO2 ingestion could result in liver fibrosis and oxidative stress in Sprague–Dawley rats, along with representative collagen deposition and HSCs activation. In addition, the inositol‐requiring enzyme 1α (IRE1α)–endoplasmic reticulum (ER)‐stress pathway was activated, and the activity of nicotinamide adenine dinucleotide phosphate oxidase 4 (NOX4) was upregulated in rat livers. Simultaneously, the excessive production of reactive oxygen species (ROS) could induce HSCs activation, and NOX4 played an important role in generating ROS in vitro. Moreover, ER stress occurred with HSCs activation at the same time under NaAsO2 exposure, and during ER stress, the IRE1α pathway was responsible for NOX4 activation. Therefore, inhibition of IRE1α activation could attenuate the HSCs activation induced by NaAsO2. In conclusion, the present study manifested that inorganic arsenic exposure could activate HSCs through IRE1α/NOX4‐mediated ROS generation. 相似文献
12.
13.
The distribution of P2Y2 receptor-immunoreactive (ir) neurons and fibers and coexistence of P2Y2 with P2X2 and P2X3 receptors, neuropeptide Y (NPY), calretinin (CR), calbindin (CB) and nitric oxide synthase (NOS) was investigated with immunostaining
methods. The results showed that P2Y2-ir neurons and fibers were distributed widely in myenteric and submucous plexuses of the guinea pig stomach corpus, jejunum,
ileum and colon. The typical morphology of P2Y2-ir neurons was a long process with strong positive staining on the same side of the cell body. The P2Y2-ir neurons could be Dogiel type 1. About 40–60% P2X3-ir neurons were immunoreactive for P2Y2 in the myenteric plexus and all the P2X3-ir neurons expressed the P2Y2 receptor in the submucosal plexus; almost all the NPY-ir neurons and the majority of CR-ir neurons were also immunoreactive
for P2Y2, especially in the myenteric plexus of the small intestine; no P2Y2-ir neurons were immunoreactive for P2X2 receptors, CB and NOS. It is shown for the first time that S type/Dogiel type 1 neurons with fast P2X and slow P2Y receptor-mediated
depolarizations could be those neurons expressing both P2Y2-ir and P2X3-ir and that they are widely distributed in myenteric and submucosal plexuses of guinea pig gut. 相似文献
14.
The effects of Ca(NO3)2 stress on biomass production, oxidative damage, antioxidant enzymes activities and polyamine contents in roots of grafted
and non-grafted tomato plants were investigated. Results showed that when exposed to 80 mM Ca(NO3)2 stress, the biomass production reduction in non-grafted plants was more significant than that of grafted plants. Under Ca(NO3)2 stress, superoxide anion radical (O2•−) producing rate, hydrogen peroxide (H2O2) and malondialdehyde (MDA) contents of non-grafted plants roots were significantly higher than those of grafted plants, however,
nitrate (NO3
−), ammonium (NH4
+) and proline contents, superoxide dismutase (SOD, EC1.15.1.1), peroxidase (POD, EC1.11.1.7), catalase (CAT, EC1.11.1.6) and
arginine decarboxylase (ADC, EC 4.1.1.19) activities of grafted plants roots were significantly higher than those of non-grafted
plants. Regardless of stress, free, conjugated and bound polyamine contents in roots of grafted plants were significantly
higher than those of non-grafted plants. The possible roles of antioxidant enzymes, prolines and polyamines in adaptive mechanism
of tomato roots to Ca(NO3)2 stress were discussed.
Gu-Wen Zhang and Zheng-Lu Liu contributed equally to this work. 相似文献
15.
Leptin, a liver profibrogenic cytokine, induces oxidative stress in hepatic stellate cells (HSCs), with increased formation of the oxidant H2O2, which signals through p38 and extracellular signal-regulated kinase 1/2 (ERK1/2) pathways, stimulating tissue inhibitor of metalloproteinase-1 production. Since oxidative stress is a pathogenic mechanism of liver fibrosis and activation of collagen gene is a marker of fibrogenesis, we evaluated the effects of leptin on collagen I expression. We report here that, in LX-2 human HSCs, leptin enhances the levels of alpha1(I) collagen mRNA, promoter activity and protein. Janus kinase (JAK)1 and JAK2 were activated. H2O2 formation was increased; this was prevented by the JAK inhibitor AG490, suggesting a JAK-mediated process. ERK1/2 and p38 were activated, and the activation was blocked by catalase, consistent with an H2O2-dependent mechanism. AG490 and catalase also prevented leptin-stimulated alpha1(I) collagen mRNA expression. PD098059, an ERK1/2 inhibitor, abrogated ERK1/2 activation and suppressed alpha1(I) collagen promoter activity, resulting in mRNA down-regulation. The p38 inhibitor SB203580 and overexpression of dominant negative p38 mutants abrogated p38 activation and down-regulated the mRNA. While SB203580 had no effect on the promoter activity, it reduced the mRNA half-life from 24 to 4 h, contributing to the decreased mRNA level. We conclude that leptin stimulates collagen production through the H2O2-dependent and ERK1/2 and p38 pathways via activated JAK1 and JAK2. ERK1/2 stimulates alpha1(I) collagen promoter activity, whereas p38 stabilizes its mRNA. Accordingly, interference with leptin-induced oxidative stress by antioxidants provides an opportunity for the prevention of liver fibrosis. 相似文献
16.
Significant part of our work was developing a new type of CO2 and H2O gas exchange chambers fit for measuring stand patches. Ground areas of six chambers (ranged between 0.044–4.531 m2) constituted a logarithmic series with doubling diameters from 7.5 to 240.0 cm. We demonstrate one of the first results for stand net ecosystem CO2 exchange (NEE) rates and temporal variability for two characteristic Central European grassland types: loess and sand. The measured mean NEE rates and their ranges in these grasslands were similar to values reported in other studies on temperate grasslands. We also dealt with the spatial scale dependence from ecophysiological point of view. Our chamber-series measurement was performed in a perennial ruderal weed association. The variability of CO2-assimilation of this weed vegetation showed clear spatial scale-dependence. We found the lowest variability of the vegetation photosynthesis at the small-middle scales. The results of spatial variability suggest the 0.2832 m2 patch size is the characteristic unit of the investigated weed association and there is a kind of synphysiological minimi-area with characteristic size for each vegetation type.This work was supported by the Hungarian Scientific Research Fund (OTKA-32586), Plant Ecological Research Group of Hungarian Academy of Sciences, Kiskunsag National Park and CARBOMONT (EVK2-2002-00549) 5th R & D EU project. This project is also related to CARBOEUROPE-IP (GOCE-CT-2003-50-5572) and GREENGRASS 5th Framework Research Project (EVK-2-CT-2002-00105).Dedicated to Academician Prof. Gabor Fekete on the occasion of his 75th birthday. 相似文献
17.
Belo CA Toyama MH Toyama Dde O Marangoni S Moreno FB Cavada BS Fontana MD Hyslop S Carneiro EM Boschero AC 《The protein journal》2005,24(3):147-153
A new Phospholipase A2 (PLA2) from Micrurus dumerilii carinicauda venom was isolated and its primary structure determined. This new PLA2 showed a low enzymatic activity when compared with other PLA2s and it is moderately basic with an isoelectric point of 8.0. Its amino acid sequence showed the presence of 120 amino acid residues and its sequence was: NLIQFLNMIQCTTPGREPLVAFANYGCYCGRGGSGTPVDELDRCCQVHDNCYDTAKKVFGCSPYFTMYSYDCSEGKLTCKDNNTKCKAAVCNCDRTAALCFAKAPYNDKNYKIDLTKRCQ. The structural model of MIDCA1, when compared with other strong neurotoxic PLA2s, such as Naja naja, showed significant differences in the β-wing and neurotoxic sites, despite the high level of amino acid sequence similarity. These observations indicate a dissociation between the biological and catalytic activity of this new PLA2, supporting the view that other regions of the protein are involved in the biological effects. 相似文献
18.
Synechococcus sp. RF-1, a unicellular N2-fixing cyanobacterium, can grow photosynthetically and diazotrophically in continuous light. How the organism protects its
nitrogenase from damage by oxygen is unclear. In cyanobacerial cells, electron transport carriers associated with photosynthesis
and respiration are all on the thylakoid membranes and share some common components, including plastoquinone pool and cytochrome
b
6
f complex, and the pathways are interacting with each other. In this work, a pulse amplitude modulation (PAM) fluorometer (PAM-101)
and an O2 electrode are used simultaneously to study the chlorophyll a fluorescence and to monitor O2 exchanges in Synechococcus sp. RF-1 cells. At the CO2 compensation point, the photochemical quenching activity remained high unless the O2 was exhausted by the glucose oxidase system (GOS). It indicates that in addition to CO2, O2 can also act as electron acceptor to receive electrons derived from QA. Studies with various inhibitors of the electron transport chain demonstrated that 3-(3,4-dichlorophenyl)-1,1-dimethylurea
(DCMU), 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone (DBMIB) and salicylhydroxamic acid (SHAM) inhibited the photoreduction of O2, while glycolaldehyde, disalicylidenepropanediamine (DSPD), methyl viologen (MV) and KCN did not. These results imply that
a KCN-resistant and SHAM-sensitive oxidase transfers electrons generated from Photosystem II to O2 between cytochrome b
6
f complex and ferredoxin. When SHAM blocked this alternative electron transport pathway, the dinitrogen-fixing activity decreased
significantly. The results indicate that a novel oxidase may function as an intracellular O2-scavenger in Synechococcus sp. RF-1 cells.
This revised version was published online in June 2006 with corrections to the Cover Date. 相似文献
19.
Observations that dopaminergic antagonists are beneficial in bipolar disorder and that dopaminergic agonists can produce mania suggest that bipolar disorder involves excessive dopaminergic transmission. Thus, mood stabilizers used to treat the disease might act in part by downregulating dopaminergic transmission. In agreement, we reported that dopamine D2-like receptor mediated signaling involving arachidonic acid (AA, 20:4n-6) was downregulated in rats chronically treated with lithium. To see whether chronic carbamazepine, another mood stabilizer, did this as well, we injected i.p. saline or the D2-like receptor agonist, quinpirole (1 mg/kg), into unanesthetized rats that had been pretreated for 30 days with i.p. carbamazepine (25 mg/kg/day) or vehicle, and used quantitative autoradiography to measure regional brain incorporation coefficients (k*) for AA, markers of signaling. We also measured brain prostaglandin E2 (PGE2), an AA metabolite. In vehicle-treated rats, quinpirole compared with saline significantly increased k* for AA in 35 of 82 brain regions examined, as well as brain PGE2 concentration. Affected regions belong to dopaminergic circuits and have high D2-like receptor densities. Chronic carbamazepine pretreatment prevented the quinpirole-induced increments in k* and in PGE2. These findings are consistent with the hypothesis that effective mood stabilizers generally downregulate brain AA signaling via D2-like receptors, and that this signaling is upregulated in bipolar disorder. 相似文献
20.
Shiga toxins consist of enzymatically active A and B subunit multimers. The A subunit of shiga-like toxins can be proteolytically
cleaved into two parts, A1 and A2, with A1 being responsible for toxic activity. Antibody neutralizing the A1 subunit of shiga toxin may protect against infection of the enterohemorrhagic Escherichia coli (EHEC O157:H7). It was difficult to express the full-length A1 subunit of shiga toxin 2 (stx2A1) in a previous study. We have now analyzed the full-length of stx2A1 using bioinformatics software. The data show that the carboxyl terminal (of ~15 amino-acid residues) has strong hydrophobicity
and low antigenicity. We cloned and expressed a truncated fragment of stx2A1 (15 amino-acid residues of the carboxyl terminal being removed), designated stx2a1, which can evoke a humoral immune response. Anti-Stx2a1 antibodies can neutralize the native shiga toxin 2 both in vivo and in vitro, which suggests that Stx2a1 serves as a candidate immunogen for a subunit vaccine that can also be used as the antigen to screen phage anti-shiga toxin
antibody libraries.
L. Liu and H. Zeng contributed equally to this study. 相似文献