FMRFamide-like immunoreactivity in the ventral ganglion of the fly Sarcophaga bullata: metamorphic changes.

1. Localization of FMRFamide-like immunoreactivity was examined in the ventral ganglion of the fly Sarcophaga bullata using the indirect immunofluorescent method. 2. There are six large cells in the thoracic ganglion which are highly immunoreactive at all stages of development. 3. During metamorphosis the thoracic FLI neurons shift their position from ventrolateral to mid-ventral position and their axons terminate and elaborate a highly immunoreactive dorsal neural sheath. 4. It is suggested that the dorsal neural sheath may function as a neurohaemal organ from which FMRFamide-like substances may be released into the haemolymph to act as neurohormones.     

FMRFamide-like immunoreactivity in the stomatogastric nervous system innervating the gut of the fly,Sarcophaga bullata

1. Distribution of FMRFamide-like peptide activity was examined in the stomatogastric nervous system of the adult fly, Sarcophaga bullata by the indirect immunofluorescent method.2. The neurons of the hypocerebral ganglion exhibit intense immunoreactivity and extend a thick axon bundle ventrally towards the proventriculus and crop.3. Near the mouth of the stomodeal valve a dense network of radial and circular immunoreactive processes branch off and innervate the proventriculus.4. Beyond the proventriculus, the crop duct and anterior midgut wall are also innervated by the FMRFamide-like immunoreactive processes of the nerve from the hypocerebral ganglion.5. From the pattern of innervation of the gut by FMRFamide-like immunoreactive processes it is suggested that this neuropeptide may regulate feeding activities in the adult fly.     

Vitamin requirements of the cultured flesh fly cells, Sarcophaga peregrina (Diptera, Sarcophagidae)

Essential vitamins for the growth of a cell line derived from the flesh fly, Sarcophaga peregrina, were determined. By examining the survivability of continuous passages of the cells in the chemically defined medium lacking one vitamin, thiamine, riboflavin, pantothenate and either niacin or niacinamide were found to be essential for the continuous growth of the flesh fly cells in vitro. [Originally published in Volume 37, Archives of Insect Biochemistry and Physiology, 37:283-286 (1998).] Copyright 1998 Wiley-Liss, Inc.     

Vitamin requirements of the cultured flesh fly cells,Sarcophaga peregrina (Diptera,Sarcophagidae)

Essential vitamins for the growth of a cell line derived from the flesh fly, Sarcophaga peregrina, were determined. By examining the survivability of continuous passages of the cells in the chemically defined medium lacking one vitamin, thiamine, riboflavin, pantothenate and either niacin or niacinamide were found to be essential for the continuous growth of the flesh fly cells in vitro. Arch. Insect Biochem. Physiol. 37:283–286, 1998. © 1998 Wiley-Liss, Inc.     

The ectoparasitic wasp Nasonia vitripennis (Walker) (Hymenoptera: Pteromalidae) differentially affects cells mediating the immune response of its flesh fly host,Sarcophaga bullata Parker (Diptera: Sarcophagidae)

In this study, we examined cellular immune responses in the flesh fly, Sarcophaga bullata, when parasitized by the ectoparasitoid Nasonia vitripennis. In unparasitized, young pharate adults and third instar, wandering larvae of S. bullata, four main hemocyte types were identified by light microscopy: plasmatocytes, granular cells, oenocytoids, and pro-hemocytes. Parasitism of young pharate adults had a differential effect on host hemocytes; oenocytoids and pro-hemocytes appeared to be unaltered by parasitism, whereas adhesion and spreading behavior were completely inhibited in plasmatocytes and granular cells by 60 min after oviposition. The suppression of spreading behavior in granular cells lasted the duration of parasitism. Plasmatocytes were found to decline significantly during the first hour after parasitism and this drop was attributed to cell death. Melanization and clotting of host hemolymph did not occur in parasitized flies, or the onset of both events was retarded by several hours in comparison to unparasitized pharate adults. Hemocytes from envenomated flies were altered in nearly identical fashion to that observed for natural parasitism; the total number of circulating hemocytes declined sharply by 60 min post-envenomation, the number of plasmatocytes declined but not granular cells, and the ability of plasmatocytes and granular cells to spread when cultured in vitro was abolished within 1 h. As with parasitized hosts, the decrease in plasmatocytes was due to cell death, and inhibition of spreading lasted until the host died. Isolated crude venom also blocked adhesion and spreading of these hemocyte types in vitro. Thus, it appears that maternally derived venom disrupts host immune responses almost immediately following oviposition and the inhibition is permanent. The possibility that this ectoparasite disables host defenses to afford protection to feeding larvae and adult females is discussed.     

Disruption of pupariation and eclosion behavior in the flesh fly, Sarcophaga bullata Parker (Diptera: Sarcophagidae), by venom from the ectoparasitic wasp Nasonia vitripennis (Walker) (Hymenoptera: Pteromalidae)

The action of venom from the ectoparasitic wasp, Nasonia vitripennis, was monitored by examining alterations in patterned muscular movements characteristic of pupariation and eclosion behavior in the flesh fly, Sarcophaga bullata. Venom injected into larvae prior to pupariation caused a dose-dependent delay in pupariation. Eventually, such larvae did pupariate, but puparia were abnormally formed. Barographic records revealed that all elements of pupariation behavior were present in venom-injected larvae, but pupariation behavior was not well synchronized with tanning, thus implying that the venom caused disruption in the temporal organization of central motor programs. When larvae were ligated and injected with venom posterior to the ligature, no response was evident in the posterior region, suggesting that the venom does not directly stimulate muscles or neuromuscular junctions. Injection of exogenous ecdysteroid into venom-injected larvae restored some elements of pupariation behavior, consistent with ecdysone's role in stimulating the release of anterior retraction factor and puparium tanning factor, two factors that are released from the CNS to regulate pupariation. When the venom was injected into newly emerged imagoes, the duration of extrication behavior was shortened, whereas all phases of post-eclosion behavior were lengthened. These observations imply that the venom affects CNS centers that regulate the muscular systems engaged in extrication and post-eclosion behavior.     

Unidirectional ion movements in the hindgut of larval Sarcophaga bullata (Diptera: Sarcophagidae).

1. Unidirectional Na+, K+, and Cl- fluxes were measured across the isolated hindgut of larval Sarcophaga bullata. 2. Both K+ and Cl- are actively secreted into the hindgut lumen, whereas Na+ is distributed passively. 3. The movements of K+ and Cl- are not entirely independent of each other, and the movement of one ion influences the flux of the co-ion. 4. The NH4+ ion is secreted into the hindgut by a mechanism separate from K+ secretion.     

The complete mitochondrial genome of the flesh fly, Sarcophaga impatiens Walker (Diptera: Sarcophagidae)

Approximately 2500 fly species comprise the Sarcophagidae family worldwide. The complete mitochondrial genome of the carrion-breeding, forensically important Sarcophaga impatiens Walker (Diptera: Sarcophagidae) from Australia was sequenced. The 15,169 bp circular genome contains the 37 genes found in a typical Metazoan genome: 13 protein-coding genes, 2 ribosomal RNA genes and 22 transfer RNA genes. It also contains one non-coding A t T-rich region. The arrangement of the genes was the same as that found in the ancestral insect. All the protein initiation codons are ATN, except for cox1 that begins with TCG (encoding S). The 22 tRNA anticodons of S. impatiens are consistent with those observed in Drosophila yakuba, and all form the typical cloverleaf structure, except for tRNA-Ser((AGN)) that lacks the DHU arm. The mitochondrial genome of Sarcophaga presented will be valuable for resolving phylogenetic relationships within the family Sarcophagidae and the order Diptera, and could be used to identify favourable genetic markers for species identifications for forensic purposes.     

Localization of leucokinin-like immunoreactive neurons and their metamorphic changes in the ventral ganglion of the fly,Sarcophaga bullata

The distribution of leucokinin I-like immunoreactive neurons in the ventral ganglion of the fly Sarcophaga bullata was examined by indirect immunofluorescence. In the larval ventral ganglion there are seven pairs of large, highly immunoreactive neurons distributed ventrolaterally as bilateral pairs in abdominal neuromeres 1–7. During metamorphosis, the seven pairs of larval immunoreactive neurons survive and three additional pairs of immunoreactive neurons appear within the condensed abdominal ganglion, bringing the total number of immunoreactive neurons to 10 pairs. It is suggested that the neuropeptide from the newly formed three pairs of leucokinin-like immunoreactive neurons may have some unique function in the life of the adult insect.     

Morphology and physiology of the prosternal chordotonal organ of the sarcophagid fly Sarcophaga bullata (Parker)

The anatomy and the physiology of the prosternal chordotonal organ (pCO) within the prothorax of Sarcophaga bullata is analysed. Neuroanatomical studies illustrate that the approximately 35 sensory axons terminate within the median ventral association centre of the different neuromeres of the thoracico-abdominal ganglion. At the single-cell level two classes of receptor cells can be discriminated physiologically and morphologically: receptor cells with dorso-lateral branches in the mesothoracic neuromere are insensitive to frequencies below approximately 1 kHz. Receptor cells without such branches respond most sensitive at lower frequencies. Absolute thresholds vary between 0.2 and 8m/s(2) for different frequencies. The sensory information is transmitted to the brain via ascending interneurons. Functional analyses reveal a mechanical transmission of forced head rotations and of foreleg vibrations to the attachment site of the pCO. In summed action potential recordings a physiological correlate was found to stimuli with parameters of leg vibrations, rather than to those of head rotation. The data represent a first physiological study of a putative predecessor organ of an insect ear.     

Allatostatin-like immunoreactivity in the optic lobe of the fly Sarcophaga bullata.

An antiserum against Diploptera allastostain 1 (Dip-AST1) was used to map the distribution of allatostain containing neurons in the optic lobes of the fly Saccrophaga bullata. Strongly immunoreacting neurons were found in two areas of the optic ganglia, namely, the medulla and the area between medulla and lobula. These cells were generally interneurons arborizing the base of the medulla. The positive reaction of specific populations of the optic lobe neurons against allatostain antiserum suggests some role for this neuropeptide in the visual physiology of the fly.     

Developmental cytology of the midgut in the flesh-fly, Sarcophaga bullata (Parker)

The cytological comparisons of the midgut in Sarcophaga bullata (Parker) between the second instar, the third instar larvae and the adult are made. The adult midgut differs from that of the larvae in the following ways: (1) the peritrophic membrane is thicker than in the larvae and has become multi-layered; (2) epithelial cells are smaller; (3) branched microvilli are present throughout the entire midgut instead of being present only in the posterior region as in the larval midgut; (4) nuclear pores are less frequent; (5) lysosome-type structures occur less frequently; (6) the basal membrane is thicker; (7) the z-bands in the surrounding muscle fibers are more distinct in adults. The possible function and the significance of these structures related to previous observations in Sarcophaga and other Diptera are discussed.     

Comparison of the effects of pyrokinins and related peptides identified from arthropods on pupariation behaviour in flesh fly (Sarcophaga bullata) larvae (Diptera: Sarcophagidae)

Peptides from the pyrokinin/PBAN family and some structurally related compounds identified in various arthropods were tested for acceleration of puparial contraction in flesh fly larvae. Modifications of behavioural patterns of pupariation were further studied for the active compounds using a behavioural analysis based on the recording of changes in tension of the cuticle. Nine peptides belonging to the pyrokinin/PBAN family (Lem-PK, Pea-PK-5, Lom-PK II, Hez-PBAN, Bom-DH-I), identified in five different insect species, two pyrokinin peptides derived from the genome of Drosophila melanogaster (capa-3, and hugin), and two pyrokinins identified from the white shrimp Penaeus vannamei were very active in the pupariation assay, with threshold doses within the range of 0.1-5.0 pmol larva(-1). High activity was also detected for a related peptide ETH1 from Drosophila. All of these peptides share a C-terminal PRLamide, which is essential and sufficient for the activity. Interestingly, two other structurally related peptides from Drosophila--ETH2 and capa-1--which feature conservative changes (Ile and Val, respectively) at the C-terminal Leu position, were inactive within a physiological range of concentrations. It is clear that the receptor mediating the acceleration of puparial contraction behaviour is sensitive to the introduction of greater steric bulk at the C-terminal Leu position. The peptides that accelerated pupariation showed very similar patterns of muscular and cuticular activity.     

Sarcophaga (Liosarcophaga) dux (Diptera: Sarcophagidae): A flesh fly species of medical importance

Background

Although tropical climate of Thailand is suitably endowed with biodiversity of insects, flies of medical importance is not well investigated. Using information from literature search, fly survey approach and specialist’s experience, we review database of Sarcophaga (Liosarcophaga) dux Thomson (Diptera: Sarcophagidae), one of the priorities flesh fly species of medical importance in Thailand.

Results

This review deals with morphology, bionomics and medical involvement. Important morphological characteristics of egg, larva, puparia and adult were highlighted with illustration and/or micrographs. Search pertaining to molecular analysis used for fly identification and developmental rate of larvae were included. Medical involvement of larvae was not only myiasis-producing agent in humans and animals, but associated with human death investigations.

Conclusions

This information will enable us to accurate identify this species and to emphasis the increase medically important scene in Thailand.     

Patterns of incorporation of tritiated thymidine by the dorsal polytene foot-pad nuclei of Sarcophaga bullata (Sarcophagidae: Diptera)

The incorporation of tritiated thymidine into the DNA of the dorsal foot-pad nuclei of Sarcophaga bullata, during pharate adult development, was studied by scintillation counting and autoradiography. Incorporation was maximal on day 4 and showed a progressive temporal decline on days 5 to 8. Autoradiographs of chromosomal arms A¹, A² and D¹, from late stages of the prolonged S period, showed discontinuous incorporation. On days 7 and 8 loci which incorporated the radio-labeled precursor were almost exclusively associated with DNA granules. DNA granules were associated with 8 specific loci in chromosomal arm A¹, 10 in A², and 8 in D¹. The relationship between patterns of incorporation of tritiated thymidine and DNA granules is discussed.Deceased June 15, 1975     

Isolation and identification of a cAMP generating peptide from the flesh fly,Neobellieria bullata (Diptera: Sarcophagidae)

The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used in combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobellieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGLIIAYNVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 μg Neb-cGP and that 10 μg represents the lowest immunostainable amount on a Western blot. © 1996 Wiley-Liss, Inc.     

Changes in cytoskeletal actin patterns in the Malpighian tubules of the fleshfly,Sarcophaga bullata (Parker) (Diptera : Calliphoridae), during metamorphosis

Using the rhodamine-labelled phalloidin staining method in combination with detergent extraction, metamorphic changes in actin filament patterns were investigated in the Malpighian tubules of the fleshfly, Sarcophaga bullata (Parker) (Diptera : Calliphoridae). Metamorphosis in this organ implies a process of dedifferentiation, followed by a process of redifferentiation. During dedifferentiation, the large basal actin bundles of the primary cells disappear and the microvillar membrane surface of these cells decreases. Concomitantly, several vesicles are pinched off from infoldings of the brush border. In older pupae, the Malpighian tubules redifferentiate to give rise to adult tubules with actin patterns similar to those of larvae. During redifferentiation of the tubules, the secondary cells display a marked increase in the number of actin filaments in their protrusions. The primary cells in the distal part of the anterior Malpighian tubules of late pupae display a well-developed basal pattern of thick parallel actin bundles. In most cases, major changes in actin filament patterns are found simultaneously with major changes in cell shape, indicating a close relationship between these actin filaments and the process of cellular remodelling.     

Mode of action of an insect neuropeptide leucopyrokinin (LPK) on pupariation in fleshfly (Sarcophaga bullata) larvae (Diptera: Sarcophagidae)

An insect neuropeptide leucopyrokinin (LPK) (pQTSFTPRLamide) accelerates pupariation in wandering larvae of the fleshfly Sarcophaga bullata. The period of sensitivity to the action of LPK begins approximately 4 h before pupariation. Within this period the degree of acceleration of contraction into the shape of a puparium is practically independent of the age at which the larvae are injected, while acceleration of tanning is distinctly more age dependent. From ligation experiments we conclude that intact central innervation is essential for the action of LPK on puparial contraction, whereas central neurones take no part in mediation of LPK action on tanning of the cuticle. An analysis of tensiometric recordings of muscular activity revealed that the actual time of LPK accelerated puparial contraction coincides with the beginning of the immobilisation/retraction phase. LPK accelerates the switch from wandering behaviour to immobilisation/retraction behaviour but has no effect on the onset and duration of motor patterns that normally underlie puparial contraction in controls. The morphology of an accelerated puparium is normal but its formation is temporally dissociated from normal ‘contraction patterns’ that are performed a long time after the puparium has contracted. It means that neuromuscular activity of larvae accelerated by LPK does not cease upon formation of the white puparium, but continues until the whole motor programme of pupariation behaviour is completed. Apparently the peptide acts on the integument by stimulating it to contract and shrink, and no specific patterns of muscular contractions are needed to properly shape the puparium. This finding sheds a new light on our understanding of the mechanism of puparium formation.     

Phylogeny of Heteronychia: the largest lineage of Sarcophaga (Diptera: Sarcophagidae)

Sarcophaga Meigen is one of the megadiverse genera of true flies, with approximately 850 valid species worldwide. The genus is divided into about 160 subgenera, the validity of a vast majority of which has never been verified using cladistic methods. This paper deals with the mainly Palaearctic subgenus Heteronychia Brauer & Bergenstamm, which comprises 89 species and is thus the largest subunit of Sarcophaga. We performed a cladistic analysis of the group based exclusively on male morphological characters. Parsimony analyses were run on a matrix of 84 characters for 88 species. Species of the subgenera Discachaeta Enderlein and Notoecus Stein were also included in the matrix. A further analysis was carried out using a subset of characters from the terminalia alone (70 characters). The results show that the clade formed by Heteronychia, Discachaeta, and Notoecus is monophyletic, with Discachaeta emerging as polyphyletic whereas Sarcophaga (Notoecus) longestylata Strobl is nested within the Sarcophaga filia‐group. Character states supporting Heteronychia and the few well‐supported species‐groups are discussed in detail. The following synonymies are proposed: Discachaeta = Heteronychia ( syn. nov. ) and Notoecus = Heteronychia ( syn. nov. ). The paper also includes a historical background of the taxon in relation to the classification of the genus Sarcophaga over the past two centuries, as well as a terminological review of the male terminalia, particularly of the distiphallus. © 2013 The Linnean Society of London