The antihypertensive effect of peptides: a novel alternative to drugs?

Many types of bioactive peptides that inhibit angiotensin I, angiotensin I converting enzyme (ACE) and Ang II type 1 receptor (AT1) in the cardiovascular system contribute to the prevention and treatment of hypertension. These inhibitory peptides are derived from many food proteins or artificial synthetic products. Further research examining the bioavailability of ACE inhibitory peptides will lead to the development of more effective ACE inhibitory peptides and foods. Our research also demonstrates that ACE inhibitory peptide LAP may lower blood pressure with no adverse effects.     

The exogastrula-inducing peptides in embryos of the sea urchin,Anthocidaris crassispina — isolation and determination of the primary structure

Four exogastrula-inducing peptides, A, B, C, and D have been isolated from the homogenates of embryos of the sea urchin, Anthocidaris crassispina, with successive chromatographic fractionations. The complete amino acid sequences of the peptides A and D were determined by analysis of the peptides generated by their digestion with lysyl endopeptidase. They were composed of 52 and 53 amino acid residues, and their molecular weights were calculated to be 5754 and 5737, respectively. The sequences of peptides A and D were DSVYQCNRDTNSCDGFGKCEKSTFGRTTGQYICNCDDGYRNNAYGGCSPRTE, and DTVARCERDTKNCDGHGTCQLSTFGRRTGQYICFCDAGYRKPNSYGGCSPSSA, respectively. The biological significance of the exogastrula-inducing peptides was discussed.     

Micro-determination of plasma diphenylhydantoin by gas—liquid chromatography

A selective, sensitive and precise gas—liquid chromatographic method for the determination of diphenylhydantoin in micro samples of blood plasma is described. After a double extraction with chloroform containing an analogue of diphenylhydantoin as an internal standard, the drug and standard are N,N-dimethylated in alkaline aqueous solution with methyl iodide followed by extraction into acetone. The methylated derivatives are separated gas chromatographically and measured using a flame-ionization detector. The lowest concentration of diphenylhydantoin in plasma which can be measured in a 100-μl sample is 1 μg/ml, which is well below the normal therapeutic concentration of 10–20 μg/ml in plasma. The methylated derivatives of diphenylhydantoin and the internal standard have been identified by their proton magnetic resonance spectra and mass spectra.     

Extraordinary metabolic stability of peptides containing α-aminoxy acids

The metabolic stability of peptides containing a mixed sequence of α-aminoxy acids and α-amino acids is significantly improved compared to peptides composed of only natural α-amino acids. The introduction of an α-aminoxy acid into peptide chain dramatically improves the stability of the amide bonds immediately before and after it. These peptides containing α-aminoxy acids represent excellent structural scaffold for the design of metabolically stable and biologically active peptides.     

Reversed-phase high-performance liquid chromatography of peptides of porcine pepsin prepared by the use of various forms of immobilized α-chymotrypsin

Reversed-phase high-performance liquid chromatography (RP-HPLC) separation was used for the comparison of peptide maps of pepsin after its digestions by different forms of immobilized α-chymotrypsin. Porcine pepsin was hydrolysed with soluble α-chymotrypsin, with α-chymotrypsins glycosylated with lactose or galactose coupled to hydrazide derivative of cellulose, with α-chymotrypsin attached to poly(acrylamide-allyl glycoside) copolymer or to glycosylated hydroxyalkyl methacrylate copolymer Separon or to agarose gel Sepharose 4B. Efficiency of enzymatic protein cleavage with regard to peptide mapping of porcine pepsin has been examined by the use of α-chymotrypsins immobilized by different methods. Best results were achieved after hydrolysis with α-chymotrypsin immobilized on poly(acrylamide-allyl glycoside) copolymers. α-Chymotrypsin immobilized by this way has further three times higher relative specific activity in comparison with the soluble one. Modified α-chymotrypsin was not suitable for efficient pepsin cleavage.     

The isolation and characterization of β-glucogallin as a novel aldose reductase inhibitor from Emblica officinalis

Diabetes mellitus is recognized as a leading cause of new cases of blindness. The prevalence of diabetic eye disease is expected to continue to increase worldwide as a result of the dramatic increase in the number of people with diabetes. At present, there is no medical treatment to delay or prevent the onset and progression of cataract or retinopathy, the most common causes of vision loss in diabetics. The plant Emblica officinalis (gooseberry) has been used for thousands of years as a traditional Indian Ayurvedic preparation for the treatment of diabetes in humans. Extracts from this plant have been shown to be efficacious against the progression of cataract in a diabetic rat model. Aldose reductase (ALR2) is implicated in the development of secondary complications of diabetes including cataract and, therefore, has been a major drug target for the development of therapies to treat diabetic disease. Herein, we present the bioassay-guided isolation and structure elucidation of 1-O-galloyl-β-D-glucose (β-glucogallin), a major component from the fruit of the gooseberry that displays selective as well as relatively potent inhibition (IC(50) = 17 μM) of AKR1B1 in vitro. Molecular modeling demonstrates that this inhibitor is able to favorably bind in the active site. Further, we show that β-glucogallin effectively inhibits sorbitol accumulation by 73% at 30 μM under hyperglycemic conditions in an ex-vivo organ culture model of lenses excised from transgenic mice overexpressing human ALR2 in the lens. This study supports the continued development of natural products such as β-glucogallin as therapeutic leads in the development of novel therapies to treat diabetic complications such as cataract.     

Separation of complexes containing protein A and IgG or Fcγ fragments by high-performance liquid chromatography

Protein A of Staphylococcus aureus is a bivalent Fc receptor that can form complexes with immunoglobulin G (IgG) or Fcγ fragments that activate humoral (e.g., complement) and cellular (e.g., lymphocyte) components of the immune system both in vitro and in vivo. To obtain complexes formed between protein A of Staphylococcus aureus (SpA) and rabbit IgG or Fcγ fragments for purposes of characterizing their compositions and studying their biological activities, we have used high-performance liquid chromatography to separate complexes in 20 min. Complexes were prepared with trace amounts of ¹²⁵I-SpA and ¹³¹I-IgG or ¹³¹I-Fcγ to simplify the analyses. With excess molar amounts of IgG or Fcγ the complexes have the molecular formulas [(IgG)₂SpA]₂ or [(Fcγ)₂SpA]₂. With excess SpA, complexes corresponding to (IgG)(SpA) or (Fcγ)(SpA) are formed, perhaps with other complexes that have different ratios of components. Since SpA is a rod-shaped molecule it elutes at a molecular weight corresponding to 240,000 rather than the true value of 42,000. This behavior is reflected in the elution of certain complexes at shorter retention times than expected on the basis of actual molecular weights, and facilitates separation of complexes from free IgG or Fcγ. The true molecular weights and molecular formulas of complexes isolated by HPLC were verified by ultracentrifugation. This HPLC method was used to study the interconversion and stability of complexes.     

Quantitative analysis of two opioid peptides in plasma by liquid chromatography–electrospray ionization tandem mass spectrometry

Quantitative analysis of two opioid peptides, DSLET [(d-Ser²)Leu-enkephalin-Thr⁶] and Met-enkephalin-Arg-Gly-Leu, was performed using microbore liquid chromatography interfaced to electrospray ionization tandem mass spectrometry. Validation of the methodology was demonstrated for each peptide in plasma. Quantitative analyses were performed through the use of a deuterium labelled peptide analog as an internal standard. Linearity was observed for the analysis of DSLET (5–1000 ng/ml) and Met-enkephalin-Arg-Gly-Leu (1–1000 ng/ml) in plasma with a limit of detection of 0.25 ng/ml for Met-enkephalin-Arg-Gly-Leu and 1.0 ng/ml for DSLET. In general, the observed concentrations showed good reproducibility with coefficients of variation of within 15%. In the concentration range studied, only 0.5 ml of plasma was required for optimal detection of Met-enkephalin-Arg-Gly-Leu and 0.25 ml for DSLET. Application of this method was demonstrated by studying the disposition of DSLET in a rat. DSLET administered to a rat exhibited a short half-life and a high clearance value.     

The role of host-specificity in the reproductive isolation of Epichloë endophytes revealed by reciprocal infections

Speciation in sexually reproducing organisms hinges on reproductive barriers that reduce gene flow between species or preclude the formation of hybrids. Here, we studied potential reproductive barriers in four members of the Epichloë typhina (Ascomycota, Clavicipitaceae) complex, i.e. Epichloë typhina infecting Dactylis glomerata, E. typhina subsp. clarkii infecting Holcus lanatus, E. typhina subsp. poae infecting Poa nemoralis and E. typhina infecting P. trivialis. Reciprocal inoculation tests showed that these endophytes are host-specific. This suggests that reproductive isolation among Epichloë strains may be the result of specialization to one host, on which mating between different individuals occurs. Furthermore, significantly lower infection frequencies of F1 progeny from crosses between host-strains compared to parental strains and within host-strain progeny suggest that host-dependent effects upon hybrid fitness exist, which would conform to an extrinsic postzygotic isolation barrier. Our results may explain, why members of the E. typhina complex remain genetically differentiated in natural populations.     

Cyanobactins—ribosomal cyclic peptides produced by cyanobacteria

Cyanobactins are small cyclic peptides that are produced by a diverse selection of cyanobacteria living in symbioses as well as terrestrial, marine, or freshwater environments. They include compounds with antimalarial, antitumor, and multidrug reversing activities and potential as pharmaceutical leads. Cyanobactins are produced through the proteolytic cleavage and cyclization of precursor peptides coupled with further posttranslational modifications such as heterocyclization, oxidation, or prenylation of amino acids. Cyanobactin gene clusters encode two proteases which cleave and cyclisize the precursor peptide as well as proteins participating in posttranslational modifications. The bioinformatic mining of cyanobacterial genomes has led to the discovery of novel cyanobactins. Heterologous expression of these gene clusters provided insights into the role of the genes participating in the biosynthesis of cyanobactins and facilitated the rational design of novel peptides. Enzymes participating in the biosynthesis of cyanobactins may prove useful as catalysts for producing novel cyclic peptides in the future. The recent discovery of the cyanobactin biosynthetic pathway in cyanobacteria extends our knowledge of their potential as producers of interesting metabolites.     

An examination of the utility of photogenerated reagents by using α-chymotrypsin

As a test of the labelling characteristics of photogenerated reagents, an aryl azide was photolysed in the aromatic-binding locus of a protein of known tertiary structure. The acyl-enzyme derived from the reaction of alpha-chymotrypsin with the p-nitrophenyl ester of p-azido[(14)C]cinnamate was isolated and photolysed. About 60% of the acyl group is covalently bound to the protein after photolysis and deacylation, and labelled enzyme is inactive. The covalently attached label is localized in the C chain of chymotrypsin, and there are firm indications that the major labelled tryptic fragment of the C chain is that which constitutes the aromatic-binding locus of the enzyme. The high degree of labelling of that portion of the protein molecule predicted on the basis of the known chemistry and structure of alpha-chymotrypsin, provides gratifying confirmation of the utility of the photo-labelling method.     

The analysis of low levels of γ-glutamyltransferase activity by high-performance liquid chromatography with electrochemical detection

A method for the analysis of low levels of the enzyme γ-glutamyltransferase in biological samples by high-performance liquid chromatography with electrochemical detection is described. A γ-glutamyl moiety from glutathione is transferred by the enzyme to glycylglycine to produce a tripeptide which is assayed directly after a purification step using octadecylsilica. Confirmation of the method is by use of the inhibitor AT-125. The method is used to measure the level of enzyme activity in rodent tissues and in cultured cells.     

Preparative isolation of bio-markers from the leaf exudate of Aloe ferox (“aloe bitters”) by high performance counter-current chromatography

One of the most crucial factors determining the safety and efficacy of any herbal medicine or natural product-based formulation is the quality of the raw material. The absence of readily available bio-markers (standards) is one of the hurdles which need to be overcome to develop robust and effective quality control protocols.Aloe ferox Mill. is a most coveted ethnomedicinally import plant indigenous to South Africa. A. ferox has been used since ancient times in folk medicine and recently it has gained popularity as an ingredient in cosmetic formulations and food supplements. This study aimed to develop a superior method for the isolation of bio-markers from “aloe bitters” (exudate) obtained from A. ferox.For separation by HPCCC the solvent system comprising of EtOAc/n-BuOH/H₂O (3.5:1.5:5, v/v/v) was used in reversed phase mode. By this method, and only in one run, eight bio-markers were separated and isolated on semi-preparative scale including aloesin, aloeresin C, aloeresin A, 5-hydroxyaloin, aloin B, aloinoside B, aloin A and aloinoside A. The isolation of bio-active molecules from A. ferox (Cape aloes) is presented to illustrate the efficiency and advantages of high performance counter-current chromatography (HPCCC).     

Micro-determination of clonazepam in plasma or serum by electron-capture gas—liquid chromatography

A rapid method is described for the electron-capture gas chromatographic determination of clonazepam in plasma or serum using methyl-clonazepam as an internal standard. The analysis is performed isothermally on the silicone stationary phase SP-2510DA (Supelco). With this liquid phase, gas chromatographic properties are comparable to methods involving acid hydrolysis or derivatisation. A short pre-column containing another phase is added to enhance resolution. The method involves a single extraction, requires 100 μl of sample and has a detection limit of 3 nmol/l. Response is linear at concentrations from 5–900 nmol/l and thus clonazepam analysis both during therapy and after overdosage is possible. Plasma and serum clonazepam levels are interchangeable.     

Biosynthesis of peptides containing α-aminoadipic acid and cysteine in extracts of a Cephalosporium sp

1. Three intracellular peptides found in small amount in a Cephalosporium sp. were rapidly labelled when dl-[(14)C]valine was added to a shaken suspension of the organism. More (14)C was incorporated into peptide P3, delta-(l-alpha-aminoadipyl)-l-cysteinyl-d-valine, than into peptide P2 (containing alpha-aminoadipic acid, cysteine, valine and glycine) or peptide P1 (containing beta-hydroxyvaline in place of the valine in peptide P2). 2. Peptides P3 and P2, but not peptide P1 were formed in a broken-cell system from the Cephalosporium sp. in the presence of delta-(l-alpha-aminoadipyl)-l-cysteine and dl-[(14)C]valine. No synthesis was observed in the presence of delta-(d-alpha-aminoadipyl)-l-cysteine or of dl-alpha-amino[(14)C]adipic acid and l-cysteinyl-l-valine or l-cysteinyl-d-valine. 3. The biosynthesis of these peptides was catalysed by the particulate fraction of the broken-cell system, whereas that of glutathione was catalysed by the supernatant fraction. 4. These results are discussed in relation to penicillin N and cephalosporin C biosynthesis.     

Determination of urinary valproylcarnitine by gas chromatography—mass spectrometry with selected-ion monitoring

A modified method for the determination of valproylcarnitine in urine samples of patients receiving sodium valproate by gas chromatography—mass spectrometry with selected-ion monitoring is described. The chemically analogous internal standard 2-ethylpentanoylcarnitine was added to the urine samples. Valproic acid and its metabolites were removed by extraction with chloroform at pH 5.0. The samples were then applied onto a C₁₈ Sep-Pak column. Inorganic and water soluble compounds were washed out with water. Valproylcarnitine and internal standard were eluted with methanol and were derivatized to the corresponding acyl-containing lactones by heating at 100°C for 60 min in dimethylformamide. Urinary valproylcarnitine levels of epileptic patients receiving valproate were determined according to the present method. The data obtained might be useful for diagnosis of carnitine deficiency.