Spores of a New Microsporidan Species Parasitizing Molluscan Neurons

Synopsis.
A new species of Microsporida was observed in neurons of the marine mollusc Aplysia californica and the ultrastructure of its spores was investigated. The spores were ˜ 1.3 m long and had a thick 3-layered coat. An anchoring disc and polar aperture were present. The polaroplast occupied most of the anterior half of the spore. The vesicular portion included lengths of loosely packed lamellar structures as well as the usual vesicular profiles embedded in fibrillar material; it was entirely surrounded by tightly packed, electron-dense lamellae. The polar tube had 5 or 6 coils. In this stage of the life cycle (mature spores), the parasites did not appear to be disturbing the host cells. The organism was named Microsporidium aplysiae sp. n.     

Effects of Some Benzimidazole Derivatives on Electrical Activity in Molluscan Neurons

We studied the effects of application of bemitil, 2-ethylbenzimidazole hydrochloride, and 2-methyl benzimidazole hydrochloride in 10^-5 and 10^-4 M concentration on identified molluscan neurons. It was found that the agents exert clear neurotropic effect, which, as we assume, are determined by their influence on different types of ion channels.     

Cyclic Nucleotides Induce Long-Term Augmentation of Glutamate-Activated Chloride Current in Molluscan Neurons

1.Literature data indicate that serotonin induces the long-term potentiation of glutamate (Glu) response in molluscan neurons. The aim of present work was to elucidate whether cyclic nucleotides can cause the same effect. 2. Experiments were carried out on isolated neurons of the edible snail (Helix pomatia) using a two-microelectrode voltage-clamp method. 3. In the majority of the cells examined, the application of Glu elicited a Cl- -current. The reversal potential (Er) of this current lied between -35 and -55 mV in different cells. 4. Picrotoxin, a blocker of Cl- -channels, suppressed this current equally on both sides of Er. Furosemide, an antagonist of both Cl- -channels and the Na+/K+/Cl- -cotransporter, had a dual effect on Glu-response: decrease in conductance, and shift of Er to negative potentials. 5. A short-term (2 min) cell treatment with 8-Br-cAMP or 8-Br-cGMP caused long-term (up to 30 min) change in Glu-response. At a holding potential of -60 mV, which was close to the resting level, an increase in Glu-activated inward current was observed. This potentiation seems to be related to the right shift of Er of Glu-activated Cl- -current rather than to the increase in conductance of Cl- -channels. The blocking effect of picrotoxin rested after 8-Br-cAMP treatment. 6. The change in the Cl- -homeostasis as a possible mechanism for the observed effect of cyclic nucleotides is discussed.     

Nitrite and Nitrate Levels in Individual Molluscan Neurons: Single-Cell Capillary Electrophoresis Analysis

Abstract: Cell and tissue concentrations of NO₂^? and NO₃^? are important indicators of nitric oxide synthase activity and crucial in the regulation of many metabolic functions, as well as in nonenzymatic nitric oxide release. We adapted the capillary electrophoresis technique to quantify NO₂^? and NO₃^? levels in single identified buccal neurons and ganglia in the opisthobranch mollusc Pleurobranchaea californica, a model system for the study of the chemistry of neuron function. Neurons were injected into a 75-µm separation capillary and the NO₂^? and NO₃^? were separated electrophoretically from other anions and detected by direct ultraviolet absorbance. The limits of detection for NO₂^? and NO₃^? were <200 fmol (<4 µM in the neurons under study). The NO₂^? and NO₃^? levels in individual neurons varied from 2 mM (NO₂^?) and 12 mM (NO₃^?) in neurons histochemically positive for NADPH-diaphorase activity down to undetectable levels in many NADPH-diaphorase-negative cells. These results affirm the correspondence of histochemical NADPH-diaphorase activity and nitric oxide synthase in molluscan neurons. NO₂^? was not detected in whole ganglion homogenates or in hemolymph, whereas hemolymph NO₃^? averaged 1.8 ± 0.2 × 10^?3M. Hemolymph NO₃^? in Pleurobranchaea was appreciably higher than values measured for the freshwater pulmonate Lymnaea stagnalis (3.2 ± 0.2 × 10^?5M) and for another opisthobranch, Aplysia californica (3.6 ± 0.7 × 10^?4M). Capillary electrophoresis methods provide utility and convenience for monitoring NO₂^?/NO₃^? levels in single cells and small amounts of tissue.     

5-Hydroxytryptamine Measurements in Molluscan Ganglia and Neurons Using a Modified Radioenzymatic Assay

A radioenzymatic procedure for the determination of sub-picomole amounts of 5-hydroxytryptamine (5-HT) is described. It is a modification of the method originally described by Saavedra et al. (1973), in which 5-HT was measured as the radiolabelled product [3H]5-methoxy-N- acetyltryptamine , after incubation with [3H]S-adenosylmethionine, acetyl-CoA, and the enzymes hydroxyindole-O-methyltransferase (EC 2.1.1.4) and N-acetyltransferase (EC 2.3.1.5). Ganglia from various gastropod molluscs (Aplysia californica, Tritonia diomedia , Lymnaea stagnalis, and Helisoma trivolvis ), as well as individual neuronal somata isolated from these ganglia, were assayed for 5-HT. Among the homologous giant cerebral cells in these animals, the 5-HT concentrations were similar. Statistical analysis of the 5-HT values in paired 5-HT-containing neurons demonstrated that the variability was considerably greater in samples obtained from different animals than in those obtained from the same animal. This suggests that experiments aimed at manipulating amine levels in individual neurons may benefit by using a paired-cell paradigm. The effects of incubating Aplysia ganglia with 5-HT or with the 5-HT precursors tryptophan and 5-hydroxytryptophan (5-HTP) were studied. High concentrations of 5-HTP and 5-HT (100 microM) increased the levels of 5-HT in ganglia, but only incubation in high concentrations of 5-HTP resulted in an increase of 5-HT in the isolated somata of 5-HT-containing neurons C1 and P5.     

Modes of Initiation and Propagation of Spikes in the Branching Axons of Molluscan Central Neurons

A study has been made of Aplysia nerve cells, mainly in the pleural ganglia, in which the main axon divides into at least two branches in the neighbourhood of the soma. Conduction between these branches was investigated by intracellular recordings from the soma following antidromic stimulation via the nerves containing the axonal branches. It has been shown that transmission between separate branches need not involve discharge of the soma but only of the axonal region between the soma and the origin of the branches. In some cells, the spike may fail to invade the other axonal branch, whereas transmission in the opposite direction is readily achieved. Often spikes in none of the branches are transmitted to the others, unless facilitated. Indications about the geometry of the neuron in the vicinity of the soma may be obtained from the study of the relative size of the A spikes originated in different branches. These observations, together with the presence of different sizes of A spikes, produced by orthodromic stimulation, provide evidence that spikes initiated at separate axonal "trigger zones" of Aplysia neurons may be conducted selectively to the effectors or other neurons innervated by the particular branch.     

Novel ω-Conotoxins Block Dihydropyridine-Insensitive High Voltage-Activated Calcium Channels in Molluscan Neurons

Abstract: We have identified two novel peptide toxins from molluscivorous Conus species that discriminate subtypes of high voltage-activated (HVA) calcium currents in molluscan neurons. The toxins were purified using assays on HVA calcium currents in the caudodorsal cells (CDCs) of the snail Lymnaea stagnalis . The CDC HVA current consists of a rapidly inactivating, transient current that is relatively insensitive to dihydropyridines (DHPs) and a slowly inactivating, DHP-sensitive L-current. The novel toxins, designated ω-conotoxins PnVIA and PnVIB, completely and selectively block the transient HVA current in CDCs with little (PnVIA) or no (PnVIB) effect on the sustained L-type current. The block is rapid and completely reversible. It is noteworthy that both PnVIA and PnVIB reveal very steep dose dependences of the block, which may imply cooperativity in toxin action. The amino acid sequences of PnVIA (GCLEVDYFCGIPFANNGLCCSGNCVFVCTPQ) and of PnVIB (DDDCEPPGNFCGMIKIGPPCCSGWCFFACA) show very little homology to previously described ω-conotoxins, although both toxins share the typical ω-conotoxin cysteine framework but have an unusual high content of hydrophobic residues and net negative charge. These novel ω-conotoxins will facilitate selective analysis of the functions of HVA calcium channels and may enable the rational design of drugs that are selective for relevant subtypes.     

The Binding of Donepezil with External Mouth of K+-Channels of Molluscan Neurons

Earlier, we have shown a strong inhibitory effect of donepezil on K⁺-current of molluscan neurons (Solntseva et al., Comp Biochem Physiol 144, 319–326, 2007). In the present work, a possible interaction of donepezil with the external mouth of the channel was examined using, as a tool, tetraethylammonium (TEA), a classical antagonist of potassium channels. Experiments were conducted in isolated neurons of snail Helix aspersa using the two-microelectrode voltage-clamp technique. A high-threshold slow-inactivating K⁺-current involving Ca²⁺-dependent (I _C) and Ca²⁺-independent (I _K) components was recorded. The I _C was estimated at 30 mV, and I _K at 100 mV. The IC₅₀ values for blocking effect of donepezil on I _C varied from 5.0 to 8.9 μM in different cells. Corresponding values for I _K varied from 4.9 to 9.9 μM. The IC₅₀ values for blocking effect of TEA on I _C lied in the range of 200 to 910 μM, and on I _K lied in the range of 100 to 990 μM. The comparison of the effects of donepezil and TEA on the same cells revealed significant correlation between IC₅₀ values of these effects. The value of Spearman coefficient of correlation (r) was 0.77 for I _C (P < 0.05), and 0.82 for I _K (P < 0.05). In the presence of TEA, the effect of donepezil, both on I _C and I _K, appears significantly weaker than in control solution. Dose–response curves of donepezil effect both on I _C and I _K were shifted right along horizontal axis when donepezil was applied in combination with TEA. Results suggest that TEA interferes with donepezil and precludes the occupation by donepezil of its own site. We suppose that the site for donepezil is situated near the TEA site with possible overlap.     

Mechanisms of Contraction in Molluscan Muscle

The muscles of molluscs show a wide variety of structural types,a variation that is paralleled by the behavior of the muscles.All these muscles have certain features in common; they containlong filaments of two types, but differ in the length and thicknessof the thick filaments and in the proportion of the protein,paramyosin, in the muscle. Structural and physiological experimentssuggest that the basic contractile mechanism is the same inall molluscan muscles. The muscle-relaxing mechanism, however,may be specialized, particularly in certain smooth muscles whichhave the very slow relaxation characteristic of "catch" muscles.     

Postinhibitory overshoot of insulin release by gastric inhibitory polypeptide

Following intravenous infusion of somatostatin $\text{in vivo}$ occasionally there is a large rebound overshoot of insulin release. An $\text{in vitro}$ model to simulate this phenomenon was made by perfusing rat pancreas with gastric inhibitory polypeptide (GIP) during simultaneous perfusion with somatostatin. Adding GIP (100 ng/ml) to the perfusate for 2 minutes beginning either 3 or 9 minutes before terminating the somatostatin perfusion produced a large overshoot in insulin release. The magnitude of overshoot was greater when medium contained 300 mg/dl glucose that when it contained 150 mg/dl glucose. Perfusion with GIP for 2 minutes beginning 9 minutes before increasing the glucose concentration of the medium from 30 to 300 mg/dl elicited a large increase in both the acute and second-phase release of insulin. These suggest that post-inhibitory overshoot of insulin release after somatostatin may be produces $\text{in vitro}$ by the suppressed action of stimulatory hormones such as GIP. Prior infusion with GIP can also potentiate glucose-stimulated insulin increase.     

The Regulation of Catch in Molluscan Muscle

Molluscan catch muscles are smooth muscles. As with mammalian smooth muscles, there is no transverse ordering of filaments or dense bodies. In contrast to mammalian smooth muscles, two size ranges of filaments are present. The thick filaments are long as well as large in diameter and contain paramyosin. The thin filaments contain actin and appear to run into and join the dense bodies. Vesicles are present which may be part of a sarcoplasmic reticulum. Neural activation of contraction in Mytilus muscle is similar to that observed in mammalian smooth muscles, and in some respects to frog striated muscle. The relaxing nerves, which reduce catch, are unique to catch muscles. 5-Hydroxytryptamine, which appears to mediate relaxation, specifically blocks catch tension but increases the ability of the muscle to fire spikes. It is speculated that Mytilus muscle actomyosin is activated by a Ca⁺⁺-releasing mechanism, and that 5-hydroxytryptamine may reduce catch and increase excitability by influencing the rate of removal of intracellular free Ca⁺⁺.     

Drag of the Cytosol as a Transport Mechanism in Neurons

Axonal transport is typically divided into two components, which can be distinguished by their mean velocity. The fast component includes steady trafficking of different organelles and vesicles actively transported by motor proteins. The slow component comprises nonmembranous materials that undergo infrequent bidirectional motion. The underlying mechanism of slow axonal transport has been under debate during the past three decades. We propose a simple displacement mechanism that may be central for the distribution of molecules not carried by vesicles. It relies on the cytoplasmic drag induced by organelle movement and readily accounts for key experimental observations pertaining to slow-component transport. The induced cytoplasmic drag is predicted to depend mainly on the distribution of microtubules in the axon and the organelle transport rate.     

Drag of the Cytosol as a Transport Mechanism in Neurons

Axonal transport is typically divided into two components, which can be distinguished by their mean velocity. The fast component includes steady trafficking of different organelles and vesicles actively transported by motor proteins. The slow component comprises nonmembranous materials that undergo infrequent bidirectional motion. The underlying mechanism of slow axonal transport has been under debate during the past three decades. We propose a simple displacement mechanism that may be central for the distribution of molecules not carried by vesicles. It relies on the cytoplasmic drag induced by organelle movement and readily accounts for key experimental observations pertaining to slow-component transport. The induced cytoplasmic drag is predicted to depend mainly on the distribution of microtubules in the axon and the organelle transport rate.     

Evolution of a Molluscan Cardioregulatory Neuropeptide

SYNOPSIS. The cardioexcitatory neuropeptide FMRFamide was firstidentified from a clam, but has now been demonstrated in severalother molluscs. It is probably present throughout the molluscanphylum though co-existing with related peptides in some species.For example, I report here the finding of the peptide phenylalanyl-leucyl-arginyl-phenylalanineamide (FLRFamide) in the mesogastropod Pomacea paludosa whereit accounts for 10–20% of the total FMRFamide-like activity.This peptide may be a minor component of the FMRFamide-likeactivity in other species as well. The pulmonate snails haveseveral, closely-related, heptapeptide analogs of FLRFamidethat are unique to them, such as pyroglutamyl-aspartyl-prolyl-phenylalanyl-leucyl-arginyl-phenylalanineamide (pQDPFLRFamide) which was isolated from Helix aspersa.Two additional pulmonate heptapeptides that have been isolatedprobably differ from pQDPFLRFamide only in their N-terminalamino acid residues. The heptapeptides account for most of theFMRFamidelike activity in the species in which they occur. Though the tetrapeptides FMRFamide and FLRFamide have virtuallyidentical activities on various molluscan tissues, the heptapeptideshave activity that is distinct from the tetrapeptides on somepulmonate muscles. 1 have attempted to explain the evolutionof this diversity of peptide structure and function found inthe modern pulmonates by postulating a gene duplication in thegastropod line leading to them.     

The Role of Lysosomes in Molluscan Inflammation1

Phagocytosis and related phenomena represent integral featuresof inflammation in all metazoans. Reviewed herein are the resultsof studies directed at understanding the role(s) of lysosomalenzymes synthesized and released from circulating hemocytes,especially granulocytes, of gastropods and bivalves as a resultof challenge with exogenous, nonself materials. From what isknown, most of the mechanisms underlying this inflammation-associatedprocess parallel those of mammalian macrophages; however, immunoglobulinsand most probably components of complement are not involved.The required energy for phagocytosis in molluscs appears tobe derived from glycolysis alone. Furthermore, nitroblue tetrazoliumreduction and the myeloperoxidase-H₂O₂-halide antimicrobialsystem, both characteristic of mammalian phagocytes, appearto be absent in molluscs. It is concluded that by studying phagocytosisby molluscan hemocytes, a great deal can be learned about theevolution of inflammatory response and its constitutent elements.     

Mechanism of Excitation of Aplysia Neurons by Carbon Dioxide

The abdominal ganglion of Aplysia californica was perfused with artificial seawater equilibrated at different P_COCO2's and pH's for 5 min or less. 5% CO₂ dropped perfusate pH from 8.0 to 6.5 and produced depolarization and increased discharge rate in visceromotor neurons. Half the giant cells studied had a similar response, whereas the other half were hyperpolarized. Pacemaker neurons showed little, if any, response to such changes in pH or CO₂. Membrane conductance of responsive cells was always increased. The effect of CO₂ occurred even when synaptic transmission was blocked by low calcium and high magnesium, and therefore must have been a direct result of CO₂ or the concomitant fall in pH. When extracellular pH was lowered to 6.5 using HCl or H₂SO₄ and no CO₂, the same effects were observed. Also, local application of HCl or H₂SO₄ to the external surface of the cell soma elicited depolarization and spike discharge. When extracellular pH was held constant by continual titration, 5–50% CO₂ had no effect. Intracellular pH was probably decreased at least one pH unit under these circumstances. Thus CO₂ per se, decreased intracellular pH, and increased bicarbonate ion were without effect. It is concluded that CO₂ acts solely through a decrease in extracellular pH.     

Cellular Neuronal Control of Molluscan Heart

Bivalve and gastropod molluscs undergo large changes in externalenvironmental conditions, as well as in internal state. Cardiacresponses to these changing conditions have been recorded ina variety of species. There is a general tendency for heartrate, and presumably cardiac output, to increase in responseto situations that would increase the load on respiratory andexcretory systems. Changes in molluscan heart function in manycases appear not to be mediated directly by cardiac nerves,but rather by such indirect mechanisms as changes in blood constituentsor mechanical, hemodynamic effects on heart muscle. Three typesof cardiac response in Aplysia have been shown to be mediated,at least in part, by the heart regulator nerves. The neural circuits that regulate heart rate in Aplysia andin Helix have been partially described in cellular detail. InMercenaria, Aplysia and other molluscan species there is evidencethat cyclic adenosine monophosphate has a role in mediatingthe excitatory effects of serotonin on heart muscle. There appearsto be, in fact, a general tendency in the Aplysia nervous systemfor neurons that exert tonic, modulatory effects within neuralnetworks that control a variety of behaviors to use serotoninfor a transmitter. In each case there is evidence to suggestthat changes in cyclic adenosine monophosphate levels may mediatesome of the modulatory effects of serotonin.