Mesh size and collection characteristics of 50-cm diameter conical plankton nets

This paper compares collection characteristics of #2-(363 µm), #10-(156 µm), and #20-(76 µm) mesh conical plankton nets: dimensions were 50-cm diameter by 1.6-m long. The #2-mesh net severely underestimated the abundances of Lake Michigan copepods and cladocerans with the exception of the largest species (Limnocalanus macrurus). Zooplankton abundance estimates were more similar for the #10- and #20-mesh nets collections. Nauplii, however, were severely undersampled by the #10-mesh net with abundance estimates approximately 8 to 12 times lower than for the #20-mesh net collections. Most other larger zooplankton were 50% more abundant in the 20-mesh net collections than in the #10-mesh net collections: such consistent differences occurred despite large variations in taxa size. This indicates that a sampling bias occurred other than the loss of zooplankton through the meshes of the #10 net. We hypothesize that, by incorrectly locating the flowmeter in the mouth of the plankton net, we underestimated the volume of water filtered by the easily-clogged #20-mesh net and therefore overestimated taxa abundances. We conclude that the #10-mesh net provided accurate estimates of microcrustacean zooplankton abundances except for nauplii. The #10-mesh net used in our study had a filtration area ratio of 3.06 and operated at a calculated average filtration efficiency of 98%. The #20-mesh net had a filtration area ratio of 1.86 and operated at calculated average filtration efficiencies ranging from 64.7% (41.7 m station) to 79.6% (6.3 m station). Calculations are presented which show how the filtration efficiencies of the nets used in our study could be improved by net redesign.     

Purification and characterization of a novel fibrinolytic protease from <Emphasis Type="Italic">Fusarium</Emphasis> sp. CPCC 480097

A novel fibrinolytic enzyme from Fusarium sp. CPCC 480097, named Fu-P, was purified to electrophoretic homogeneity using ammonium sulfate precipitation and ion exchange and gel filtration chromatography. Fu-P, a single protein had a molecular weight of 28 kDa, which was determined by SDS-PAGE and gel filtration chromatography. The isoelectric point of Fu-P determined by isoelectric focusing electrophoresis (IEF) was 8.1, and the optimum temperature and pH value were 45°C and 8.5, respectively. Fu-P cleaved the α-chain of fibrin (ogen) with high efficiency, and the β-chain and γ-γ (γ-)-chain with lower efficiency. Fu-P activity was inhibited by EDTA and PMSF, and the enzyme exhibited a high specificity for the chymotrypsin substrate S-2586. Fu-P was therefore identified as a chymotrypsin-like serine metalloprotease. The first 15 amino acids of the N-terminal sequence of Fu-P were Q-A-S–S-G-T-P-A-T-I-R-V-L-V–V and showed no homology with that of other known fibrinolytic enzymes. This protease may have potential applications in thrombolytic therapy and in thrombosis prevention.     

GEST: a gene expression search tool based on a novel Bayesian similarity metric

Gene expression array technology has made possible the assay of expression levels of tens of thousands of genes at a time; large databases of such measurements are currently under construction. One important use of such databases is the ability to search for experiments that have similar gene expression levels as a query, potentially identifying previously unsuspected relationships among cellular states. Such searches depend crucially on the metric used to assess the similarity between pairs of experiments. The complex joint distribution of gene expression levels, particularly their correlational structure and non-normality, make simple similarity metrics such as Euclidean distance or correlational similarity scores suboptimal for use in this application. We present a similarity metric for gene expression array experiments that takes into account the complex joint distribution of expression values. We provide a computationally tractable approximation to this measure, and have implemented a database search tool based on it. We discuss implementation issues and efficiency, and we compare our new metric to other standard metrics.     

Hypothetical protein AF2241 from Archaeoglobus fulgidus adopts a cyclophilin-like fold

AF2241 is a hypothetical protein from Archaeoglobus fulgidus and it belongs to the PFam domain of unknown function 369 (DUF369). NMR structural determination reveals that AF2241 adopts a cyclophilin-like fold, with a β-barrel core composed of eight β-strands, one α-helix, and one 3₁₀ helix located at each end of the barrel. The protein displays a high structural similarity to TM1367, another member of DUF369 whose structure has been determined recently by X-ray crystallography. Structural similarity search shows that AF2241 also has a high similarity to human cyclophilin A, however, sequence alignment and electrostatic potential analysis reveal that the residues in the PPIase catalytic site of human cyclophilin A are not conserved in AF2241 or TM1367. Instead, a putative active site of AF2241 maps to a negatively charged pocket composed of 9 conserved residues. Our results suggest that although AF2241 adopts the same fold as the human cyclophilin A, it may have distinct biological function. Electronic supplementary material The online version of this article (doi:) contains supplementary material, which is available to authorized users.     

Weak hierarchies associated with similarity measures—An additive clustering technique

A new and apparently rather useful and natural concept in cluster analysis is studied: given a similarity measure on a set of objects, a sub-set is regarded as a cluster if any two objectsa, b inside this sub-set have greater similarity than any third object outside has to at least one ofa, b. These clusters then form a closure system which can be described as a hypergraph without triangles. Conversely, given such a system, one may attach some weight to each cluster and then compose a similarity measure additively, by letting the similarity of a pair be the sum of weights of the clusters containing that particular pair. The original clusters can be reconstructed from the obtained similarity measure. This clustering model is thus located between the general additive clustering model of Shepard and Arabie (1979) and the standard hierarchical model. Potential applications include fitting dendrograms with few additional nonnested clusters and simultaneous representation of some families of multiple dendrograms (in particular, two-dendrogram solutions), as well as assisting the search for phylogenetic relationships by proposing a somewhat larger system of possibly relevant “family groups”, from which an appropriate choice (based on additional insight or individual preferences) remains to be made.     

Functional analysis of the α-neurotoxin, BmαTX14, derived from the Chinese scorpion, Buthus martensii Karsch

The gene encoding the BmαTX14 (α-neurotoxin TX14) protein, derived from the cDNA library of the Chinese scorpion Buthus martensii Karsch, was expressed in Pichia pastoris. The recombinant protein was purified by metal chelate affinity chromatography and gel filtration chromatography. Using patch-clamp technique, electrophysiological activity of rBmαTX14 was identified. In the neurons isolated from mice trigeminal root ganglion, the Na⁺ current amplitude was reduced by 80% under whole cell patch-clamp recording. There were no apparent modifications to the gating mechanism in the presence of rBmαTX14. Although BmαTX14 shared a high amino acid sequence similarity with other typical α-toxins, it has different effects on neurons. Further electrophysiological analysis suggested that rBmαTX14 selectively blocked Na⁺ channels and is a member of a new group of scorpion toxins.     

Anti-SARS drug screening by molecular docking

Summary. Starting from a collection of 1386 druggable compounds obtained from the 3D pharmacophore search, we performed a similarity search to narrow down the scope of docking studies. The template molecule is KZ7088 (Chou et al., 2003, Biochem Biophys Res Commun 308: 148–151). The MDL MACCS keys were used to fingerprint the molecules. The Tanimoto coefficient is taken as the metric to compare fingerprints. If the similarity threshold was 0.8, a set of 50 unique hits and 103 conformers were retrieved as a result of similarity search. The AutoDock 3.011 was used to carry out molecular docking of 50 ligands to their macromolecular protein receptors. Three compounds, i.e., C₂₈H₃₄O₄N₇Cl, C₂₁H₃₆O₅N₆, and C₂₁H₃₆O₅N₆, were found that may be promising candidates for further investigation. The main feature shared by these three potential inhibitors as well as the information of the involved side chains of SARS Cov Mpro may provide useful insights for the development of potent inhibitors against SARS enzyme.     

A platform for biological sequence comparison on parallel computers

We have written two programs for searching biological sequencedatabases that run on Intel hypercube computers. PSCANLJB comparesa single sequence against a sequence library, and PCOMPLIB comparesall the entries in one sequence library against a second library.The programs provide a general framework for similarity searching;they include functions for reading in query sequences, searchparameters and library entries, and reporting the results ofa search. We have isolated the code for the specific functionthat calculates the similarity score between the query and librarysequence; alternative searching algorithms can be implementedby editing two files. We have implemented the rapid FASTA sequencecomparison algorithm and the more rigorous Smith — Watermanalgorithm within this framework. The PSCANLIB program on a 16node iPSC/2 80386-based hypercube can compare a 229 amino acidprotein sequence with a 3.4 million residue sequence libraryin {small tilde}16s with the FASTA algorithm. Using the Smith— Waterman algorithm, the same search takes 35 min. ThePCOMPUB program can compare a 0.8 millon amino acid proteinsequence library with itself in 5.3 min with FASTA on a third-generation32 node Intel iPSC/860 hypercube. Received on September 8, 1990; accepted on December 15, 1990     

Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis

A novel antimicrobial peptide named as ixosin-B was isolated from the salivary glands of the hard tick, Ixodes sinensis, by gel filtration, ion exchange chromatography and reverse-phase high-performance liquid chromatography (RP-HPLC). Its amino acid sequence was determined as QLKVDLWGTRSGIQPEQHSSGKSDVRRWRSRY by Edman degradation. The cDNA encoding ixosin-B was cloned by cDNA library screening. The predicted protein from the cDNA sequence composed of 89 amino acids including mature ixosin-B. Purified ixosin-B exerted its antimicrobial activities against bacteria and fungi. No similarity was found by BLAST search to any database entries and, thus, our findings describe a novel antimicrobial peptide. It is also the fourth family of antimicrobial peptide from hard ticks.     

A search for common patterns in many sequences

A new approach to search for common patterns in many sequencesis presented. The idea is that one sequence from the set ofsequences to be compared is considered as a ‘basic’one and all its similarities with other sequences are found.Multiple similarities are then reconstructed using these data.This approach allows one to search for similar segments whichcan differ in both substitutions and deletions/insertions. Thesesegments can be situated at different positions in various sequences.No regions of complete or strong similarity within the segmentsare required. The other parts of the sequences can have no similarityat all. The only requirement is that the similar segments canbe found in all the sequences (or in the majority of them, giventhe common segments are present in the basic sequence). Workingtime of an algorithm presented is proportional to n.L²when nsequences of length L are analyzed. The algorithm proposed isimplemented as programs for the IBM-PC and IBM/370. Its applicationsto the analysis of biopolymer primary structures as well asthe dependence of the results on the choice of basic sequenceare discussed.     

Purification, characterization, and cDNA structure of isoamylase from developing endosperm of rice

Isoamylase (EC 3.2.1.68) in rice (Oryza sativa L.) was efficiently purified within a day to homogeneity, as confirmed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), from developing endosperm by sequential use of Q Sepharose HP anion- exchange chromatography, ammonium sulfate fractionation, and TSKgel G4000SW_XL and G3000SW_XL gel filtration chromatography. Although the protein exhibited a molecular size of ca. 83 kDa on SDS-PAGE, the apparent size of the native enzyme was approximately 340 and 490 kDa on TSKgel G3000SW_XL and G4000SW_XL gel filtration chromatograms, respectively, suggesting that rice isoamylase exists in a homo-tetramer to homo-hexamer form in developing endosperm. The purified rice isoamylase was able to debranch glycogen, phytoglycogen and amylopectin but could not attack pullulan. The optimum pH and temperature for isoamylase activity were found to be pH 6.5 to 7.0 and 30 °C, respectively. The enzyme activity was completely inhibited by HgCl₂ and p-chloromercuribenzoate at 1 mM. These results indicate that rice isoamylase possesses properties which are distinct from those reported for bacterial isoamylase. Complementary-DNA clones for rice endosperm isoamylase were isolated with a polymerase-chain-reaction product as probe which was generated by primers designed from nucleotides conserved in cDNA for maize Sugary-1 isoamylase (M.G. James et al., 1995, Plant Cell 7: 417–429) and a Pseudomonas amyloderamosa gene encoding isoamylase (A. Amemura et al., 1988, J Biol Chem 263: 9271–9275). The nucleotide sequence and deduced amino acid sequence of the longest clone showed a high similarity to those of maize Surgary-1 isoamylase, but a lesser similarity to those of Pseudomonas amyloderamosa isoamylase. Southern blot analysis and gene mapping analysis indicated that the isoamylase gene exists as a single copy in the rice genome and is located on chromosome 8 of cv. Nipponbare which belongs to the Japonica rice group. Phylogenetic analysis indicated that isoamylases from maize and rice are more closely related to a number of glgX gene products of the blue green alga Synechocystis and various bacteria than to isoamylases from Pseudomonas and Flavobacterium. Hence, it is proposed that glgX proteins are classified as isoamylase-type debranching enzymes. Our tree also showed that all starch- and glycogen-debranching enzymes from plants and bacteria tested can be classified into two distinct types, an isoamylase-type and a pullulanase-type. Received: 29 October 1998 / Accepted: 10 December 1998     

Purification and characterization of a novel cholesterol-lowering protein from the seeds of Senna obtusifolia

“Juemingzi”, a source of traditional Chinese herbal medicine, has been demonstrated to play a role in decreasing serum cholesterol concentration. In this study, a novel protein, which has shown an inhibitory effect on cholesterol biosynthesis, was isolated from Senna obtusifolia L. seed by gel filtration and ion exchange chromatography. The novel protein’s molecular mass was 19.7 kD and its pI was 4.80. Both SDS-PAGE and isoelectric-focusing (IEF) revealed a single Coomassie brilliant blue stained band, indicating that the novel protein was a single peptide. The N-terminal amino acid sequence of the protein was IPYISASFPLNIEFLPSE, which had no similarity with any other protein sequences in the NCBI protein database. Circular dichroism (CD) signals indicated that S. obtusifolia seed protein contained 12.5% α-helix, 55.6% β-sheet, and 31.9% random coil Supported by Guangdong Provincial Department of Science and Technology (Grant No. 2003C34409) and Guangzhou Civil Department of Science and Technology (Grant No. 2002Z3-85041)     

Genomic organization and refined mapping of the mouse β-dystrobrevin gene

β-Dystrobrevin, a dystrophin-related protein that is expressed in non-muscle tissues, is highly homologous to α-dystrobrevin, a member of the dystrophin-associated protein complex (DPC). β-Dystrobrevin associates with Dp71 and syntrophin and is believed to have a role in non-muscle DPCs. Here we report the characterization and mapping of the mouse β-dystrobrevin gene. The mouse β-dystrobrevin gene is organized into 21 exons spanning over 130 kb of DNA. We provide evidence that this gene is transcribed from at least two promoter regions but appears to utilize a common translation initiation site. We show that the similarity between β-dystrobrevin and α-dystrobrevin is reflected in the conservation of their exon-intron junctions. β-Dystrobrevin has been localized to proximal mouse Chromosome (Chr) 12 by backcross mapping. A database search revealed that two mouse genetic diseases involving tissues expressing β-dystrobrevin have been mapped to this region, namely, congenital polycystic kidneys (cpk) and fatty liver dystrophy (fld). However, refined mapping analysis has excluded β-dystrobrevin as a candidate gene for either disease. Received: 1 June 1998 / Accepted: 16 July 1998     

Interfacing similarity search software with the sequence retrieval system ACNUC

A method of interfacing sequence similarity search softwarewith the fast sequence retrieval system ACNUC is described.The method is written in FORTRAN 77 and is straightforward toimplement because no textprocessing code is required —a minimum of 12 extra lines of FORTRAN provided the interfacefor most applications. The method is also efficient, since sequencesare located by simple indexing techniques, with no linear searchesof large database files necessary. Received on November 20, 1986; accepted on January 8, 1987     

Mesh selection and filtration efficiency of the Continuous Plankton Recorder

The filtration efficiency [volume filtered/(inlet aperture areax distance travelled through the water)] and retention of copepodsby the Continuous Plankton Recorder (CPR) were measured in seatrials. Filtration efficiency was independent of tow speed (n= 14 trials, range of speeds 5–13 knots, F_1.12 = 0.1,P = 0.73), but was influenced by the extent to which the bodyof the CPR was sealed. The retention of copepods on the silkfiltering mesh routinely used in CPRs did not differ significantlyfrom that predicted for a 270 µm nylon mesh and did notvary with tow speed.     

Search efficiency but not response interference affects visual selection in frontal eye field

Two manipulations of a visual search task were used to test the hypothesis that the discrimination of a target from distractors by visually responsive neurons in the frontal eye field (FEF) marks the outcome and conclusion of visual processing instead of saccade preparation. First, search efficiency was reduced by increasing the similarity of the distractors to the target. Second, response interference was introduced by infrequently changing the location of the target in the array. Both manipulations increased reaction time, but only the change in search efficiency affected the time needed to select the target by visually responsive neurons. This result indicates that visually responsive neurons in FEF form an explicit representation of the location of the target in the image.     

Enhanced removal of crystal violet in water using a facile-fabricated and environmental-friendly laccase immobilized composite membrane

An effort has been made to search a cheaper, easily available and simple alternative for the immobilization of enzymes and practical utilization in dye treatment. In this study, a porous zeolite-like geopolymer membrane (Geo) was used as immobilization support considering environmental friendliness, low cost and chemical/mechanical stability. A facile “cyclic adsorption” method was adopted to prepare the laccase immobilized geopolymer composite membrane (Geo-Lac). The results indicated that the pH-temperature range and stability were improved by adding the Geo support. The feasibility of removing crystal violet (CV) by the Geo-Lac was investigated in a batch mode and a flow-through mode, respectively. More than 99 % of CV (C₀ = 5 mg/L) was removed with the Geo-Lac in a batch mode and the removal efficiency still remained over 93 % within 8 h of high-throughput filtration in a flow-through mode. Moreover, the Geo-Lac was much more durable, and after 4 cycles, it still had a removal efficiency of 90.02 ± 0.33 % for CV within 6 h of filtration. These results indicated that the porous geopolymer membrane is a promising support for both laccase immobilization and further applications in dye removal.     

Integrating computational and mixture-based screening of combinatorial libraries

Mixture-based synthetic combinatorial library (MB-SCL) screening is a well-established experimental approach for rapidly retrieving structure–activity relationships (SAR) and identifying hits. Virtual screening is also a powerful approach that is increasingly being used in drug discovery programs and has a growing number of successful applications. However, limited efforts have been made to integrate both techniques. To this end, we combined experimental data from a MB-SCL of bicyclic guanidines screened against the κ-opioid receptor and molecular similarity methods. The activity data and similarity analyses were integrated in a biometric analysis–similarity map. Such a map allows the molecules to be categorized as actives, activity cliffs, low similarity to the reference compounds, or missed hits. A compound with IC₅₀ = 309 nM was found in the “missed hits” region, showing that active compounds can be retrieved from a MS-SCL via computational approaches. The strategy presented in this work is general and is envisioned as a general-purpose approach that can be applied to other MB-SCLs.     

Properties of a cold-active protease from psychrotrophic Flavobacterium balustinum P104

Protease activity was detected in the culture medium of Flavobacterium balustinum P104 grown at 10 °C, which was isolated from salmon (Oncorhynchus keta) intestine. The enzyme, designated as CP-70 protease, was purified to homogeneity from the culture broth by ion exchange and gel filtration chromatographyies. The molecular mass of the protease was 70 kDa, and its isoelectric point was close to 3.5. Maximal activity toward azocasein was observed at 40 °C and from pH 7.0 to 9.0. The activity was strongly inhibited by phenylmethylsulfonyl fluoride, suggesting that the enzyme is a serine protease. The n-terminal amino acid sequence was Asp-Thr-Arg-Gln-Leu-Leu-Asn-Ala-Asn-Ser-Asp-Leu-Leu-Asn-Thr-Thr-Gly-Asn-Val-Thr-Gly-Leu-Thr-Gly-Ala-Phe-Asn-Gly-Glu-Asn. A search through the database for sequence homology yielded no significant match. The initial cleavage sites for oxidized insulin B-chain were found to be the Glu13-Ala14 and Phe24-Phe25 bonds. The result of the cleavage pattern of oxidized insulin B-chain suggests that CP-70 protease has a broader specificity than the other cold-active proteases against the peptide substrate. Received: 17 April 1998 / Received last revision: 17 June 1998 / Accepted: 10 July 1998     

The effect of filtration method on the efficiency of environmental DNA capture and quantification via metabarcoding

Environmental DNA (eDNA) is a promising tool for rapid and noninvasive biodiversity monitoring. eDNA density is low in environmental samples, and a capture method, such as filtration, is often required to concentrate eDNA for downstream analyses. In this study, six treatments, with differing filter types and pore sizes for eDNA capture, were compared for their efficiency and accuracy to assess fish community structure with known fish abundance and biomass via eDNA metabarcoding. Our results showed that different filters (with the exception of 20‐μm large‐pore filters) were broadly consistent in their DNA capture ability. The 0.45‐μm filters performed the best in terms of total DNA yield, probability of species detection, repeatability within pond and consistency between ponds. However performance of 0.45‐μm filters was only marginally better than for 0.8‐μm filters, while filtration time was significantly longer. Given this trade‐off, the 0.8‐μm filter is the optimal pore size of membrane filter for turbid, eutrophic and high fish density ponds analysed here. The 0.45‐μm Sterivex enclosed filters performed reasonably well and are suitable in situations where on‐site filtration is required. Finally, prefilters are applied only if absolutely essential for reducing the filtration time or increasing the throughput volume of the capture filters. In summary, we found encouraging similarity in the results obtained from different filtration methods, but the optimal pore size of filter or filter type might strongly depend on the water type under study.